(data stored in ACNUC30630 zone)

EMBL: CP001977.PE486

CP001977.PE486       Location/Qualifiers
FT   CDS_pept        521924..522796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3496"
FT                   /product="myo-inositol catabolism protein IolB"
FT                   /note="identified by match to protein family HMM PF06845"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3496"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00159"
FT                   /db_xref="GOA:D4HBR8"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBR8"
FT                   /protein_id="ADE00159.1"
FT                   /translation="MTELVLRSGSTASGCRDVVVDPKCAGWTYSGLTIASLTKDETLEL
FT                   TTDDHEYLVLPLEGSFTVQGDGFRADLAGRSTIWGEVTDYAFVPRHRTITVTAVSGGRV
FT                   ALPNALASEDLEPRYCPSTEVRVELRGAGNCSRQVVNYAVANPVHTSRLLACEVLTPGG
FT                   NWSSYPPHKHDEESQVEHELEEIYYFEIRGDEHGPGMAFHGTYGTPDRPIHVAEMISNG
FT                   DVALVPHGWHGPCAAAPGYDLYYLNVMAGPGAAEWKSVDDPHYGWIRQTWQDQDIDPRL
FT                   PLAVDDSKE"
     atgacggaac tagttcttcg atctgggagc actgcctcgg gctgtcgcga cgttgttgtt        60
     gaccctaagt gcgctggctg gacgtactcc ggtctaacta ttgcgagttt gacgaaagat       120
     gagacccttg agctgaccac cgacgaccac gagtacctcg ttctacctct ggaagggtcg       180
     ttcacagtgc agggtgatgg gttccgagcc gatctcgccg ggcgcagcac tatctggggt       240
     gaggtcaccg actatgcctt cgtgccccgt cacaggacaa tcaccgtcac tgctgtcagt       300
     ggcggacggg tggcgctgcc caacgccctc gctagtgagg accttgagcc caggtattgc       360
     ccgtccacgg aggtgcgtgt cgagctgcgt ggggcgggta attgctcgcg ccaggtggtg       420
     aactacgccg ttgctaaccc ggtgcatacc tccaggttgc tggcctgcga agttctcacc       480
     ccggggggta actggtcctc ttaccctcct cacaagcacg acgaggagtc gcaggtcgag       540
     cacgaactcg aggagatcta ctatttcgag attcgcggtg acgagcacgg cccagggatg       600
     gcattccacg ggacctatgg cacgccggac cgtcccatcc acgtggcaga gatgatttcg       660
     aacggtgacg tagctctggt gccgcatggc tggcatgggc cgtgtgcagc cgcccccggc       720
     tacgacttgt actacctcaa tgtgatggcg gggccaggcg ccgctgagtg gaaatcagtc       780
     gacgatccgc attacgggtg gattcgtcaa acttggcagg accaagatat cgacccgcgc       840
     ctgccgctag cggtggacga ctcaaaggag tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page