(data stored in ACNUC30630 zone)

EMBL: CP001977.PE491

CP001977.PE491       Location/Qualifiers
FT   CDS_pept        528151..529365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3501"
FT                   /product="oxidoreductase, NAD-binding domain protein"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3501"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99907"
FT                   /db_xref="GOA:D4HBS3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBS3"
FT                   /protein_id="ADD99907.1"
FT                   /translation="MSALSQPATSQRHPLSVAVIGAGMAGRTHANAWRQVGTVFGSEGI
FT                   PPIRLAAICDSYEPFARSARDSYGYERAVTDWHDIVDADDIDVVSVVVSNALHRQVAED
FT                   LVRAGKHVLCEKPLSDSLENARAMAELEANSQVVTGVGFSYRRHPSVAAIAELVRQGRL
FT                   GDVTTFSGRYWCGYGVDPTVPMAWRYRGPQGSGALGDLGSHIIDVAEFVCGPIRSVRGG
FT                   AFATIIDKRPPALEGVAGGRGMTVSAQAIETVENDDIAVFNMTFESGAIGTIVVSRVAF
FT                   GLPNSMEFDVFGTQGRASFDLARSGEIIVDDTSTPEGFSGPRQVLSNPTFPYYKGGSSM
FT                   DFAGVGSTQIEQFTYQARAFLDQVLGLDEGFPLVLSFAHGYRTMCIADAVARSAAAGGK
FT                   TIDLT"
     atgtcggcat tatcacaacc agccacgtcg cagcggcatc ccttgtcggt ggccgtcatc        60
     ggagccggta tggctggtcg aacgcacgcc aacgcctggc gccaggtcgg gaccgtgttc       120
     ggatccgagg ggataccccc tatacggctc gctgccatct gtgactctta cgagcccttc       180
     gcccgtagtg cccgcgacag ttatggctac gaaagagcag taactgactg gcatgacatc       240
     gtggacgctg acgatataga cgtcgtgtcg gtcgtcgtgt cgaacgcact gcatcgtcag       300
     gtcgccgagg acctggtccg ggctggcaaa catgtcctgt gtgagaagcc actgtctgac       360
     agcttggaga atgccagggc gatggctgag ctggaagcta attcccaggt cgtcaccggc       420
     gtcggcttca gttaccgacg ccacccctca gtcgctgcaa tagccgaact ggtgcgacaa       480
     ggccgtctag gtgatgttac gacgttttct gggcggtatt ggtgtgggta cggcgtcgat       540
     cccaccgtgc cgatggcatg gcgctatcga ggccctcagg gctcgggcgc cctgggggac       600
     cttggttcgc acatcatcga tgtggccgag ttcgtctgtg gtccgatacg aagcgtccgt       660
     ggtggggctt ttgccacgat tatcgataag cgtccgcccg cgctggaggg agttgcagga       720
     ggacgtggga tgacggtgtc ggcgcaggcc atcgaaaccg tggaaaatga cgacattgca       780
     gtattcaata tgaccttcga gtccggggcc attggtacga ttgtcgtttc ccgtgttgca       840
     tttggcctgc ccaattcgat ggagttcgac gtcttcggta cccaggggcg ggcctcattc       900
     gatctggccc gctccggtga gatcattgtg gacgacacat caaccccaga aggattcagc       960
     gggcctcgtc aagtattgtc caatccaact ttcccctatt acaagggtgg atcatccatg      1020
     gattttgctg gtgttggcag cactcagatc gaacaattta cctatcaagc gagggctttc      1080
     ctcgaccagg tcttggggtt ggacgaaggg tttcctctgg tgctgtcctt cgcgcacggg      1140
     taccgaacaa tgtgtatcgc cgatgccgtc gctcgatctg cggcggccgg tgggaaaacc      1200
     attgatctca cctga                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page