(data stored in ACNUC30630 zone)

EMBL: CP001977.PE492

CP001977.PE492       Location/Qualifiers
FT   CDS_pept        529410..530408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3502"
FT                   /product="AP endonuclease, family 2"
FT                   /note="identified by match to protein family HMM PF01261"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3502"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00138"
FT                   /db_xref="GOA:D4HBS4"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBS4"
FT                   /protein_id="ADE00138.1"
FT                   /translation="MSMNIGAYTACLHNYDLAEALDILKTNGLTGAEVNVGGFIPSPHC
FT                   PVDTLMTSQTAREDYMGIFEDKEMRLAGLNTSGNPLSPLPDVGPRHAYDLRRAIELAGK
FT                   LGITDLVCMSGTPGSDRHAKYPSWVVNPWNGVELEVLEYQKSVVDPFWREMDLRAQNAG
FT                   VKLALELHPHNLVFTPVNFLEFAERIDARNIGVNMDPSHLMWQGMDIIAAIELLGDHIF
FT                   HVHAKDTVILPGIATRGVLDSSFGPVPDDPDVRVQTGMEHYCSSWPSDPAWRFVAIGNG
FT                   HDVTWWTNFLRAIRDVNPGMNINIEHEDQSLAQLDGIAVSARNLLAAEQAV"
     atgtccatga atatcggggc ctacaccgcc tgtctccata actacgatct cgccgaggcg        60
     cttgacatcc ttaaaaccaa cggattgacc ggcgctgagg tcaatgtcgg cggattcatt       120
     ccctcgcctc attgtccagt cgatacgctc atgacctccc agaccgcccg cgaggactac       180
     atgggtatat tcgaggataa agaaatgcgg ctggcgggcc tgaacacgtc tggcaatccg       240
     ctcagtccgt tgcctgatgt cggtccgcgg cacgcatacg acttgcgacg ggcgatcgag       300
     ttggctggaa agctgggtat cacggatctc gtctgtatgt caggcacgcc aggatcagat       360
     cgccatgcta agtatccatc gtgggtagtt aatccgtgga atggtgtcga gcttgaagtg       420
     ctcgagtacc agaaaagtgt tgtcgacccg ttctggcgcg agatggacct gcgcgcccaa       480
     aatgctgggg tcaaactcgc cttagagctc catcctcaca accttgtttt cacgccggtg       540
     aacttcctgg agtttgccga gcgtattgac gcgaggaaca ttggcgtcaa tatggaccca       600
     tcacacctga tgtggcaggg catggatatc atcgccgcta tcgagctatt gggcgaccat       660
     atcttccatg tccatgccaa ggacaccgtc atcttgcccg ggatagcaac taggggggtg       720
     cttgactcga gttttggtcc ggtaccagat gatccggacg ttcgcgttca gacaggaatg       780
     gagcactact gctcctcgtg gccttctgat ccggcatgga gattcgtggc aatcggcaat       840
     ggccacgatg tcacgtggtg gaccaatttc cttcgtgcta tccgagacgt aaacccaggg       900
     atgaacatca atatcgagca cgaggaccaa tctctggcgc agcttgatgg tatcgctgtt       960
     tcagctcgaa acctcttggc cgcagaacag gctgtatga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page