(data stored in ACNUC30630 zone)

EMBL: CP001977.PE496

CP001977.PE496       Location/Qualifiers
FT   CDS_pept        532917..534524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3506"
FT                   /product="MFS transporter, SP family"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690; match to protein
FT                   family HMM TIGR00879"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3506"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01070"
FT                   /db_xref="GOA:D4HBS8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBS8"
FT                   /protein_id="ADE01070.1"
FT                   /translation="MVDETPPSGKHRGIGALAAVATLGSLLFGYDTGVISGALPYLYMP
FT                   HLPGGLALTPMQEGAIGGTLLIGAAIGAVTGGIMSDRWGRRHNITILAVIFLLGALGTT
FT                   FSPNVFVMYVFRFVLGFAVGAASATVPVYLAENAPKRIRGSIVAIDQLMIVTGQLLAFS
FT                   MNAIINAAHGGPQLIIKANNNPDSLGITKGTYSWDQILALQASKGGPLEGDQYRAFVEN
FT                   LVIQSGNGAAWRWMLVLCSIPAIALWIGIRLMPESARWYLAKGRVADAVGALKRVRDPQ
FT                   KDGPLDAEVEEMLVTQQRELENKYQGNAFAHVWRTPWLRKLMLVGIFLAIVNQTTGVNT
FT                   VMYYAPKVLEYAGMTTSASITAQVANGVMSVIGSVGGLWLILKFSRRSLLIFDVSAVGI
FT                   TLLVIAGTFQFTIAPHIADKTTPPTWAPYLILGLMAVFMLIVQSTNGTVVWTMLGEMFP
FT                   ANVRGIMNGTAIFFMWVINAVITFTFPSMMASLGGGLTYTIYGMMNLVIAVVLFKIMPE
FT                   TRNKSLEQIETYMEERYS"
     atggttgatg agactccgcc gtccggcaaa caccggggca tcggggcgct tgctgccgtg        60
     gcgaccctgg gatccctact ctttggatat gacacaggtg tcatatcggg ggcgcttccc       120
     tacctgtaca tgccccacct gcctggcggt ctcgccttaa caccgatgca ggagggcgcc       180
     atcggcggca cactcctcat cggcgctgca attggcgccg tgaccggcgg catcatgtcc       240
     gatcggtggg ggcggcgcca taacatcacg atactcgcgg tcatcttctt gctgggggcc       300
     ctaggcacga cgttctcgcc gaacgtgttc gtgatgtacg tcttccgctt cgtgctggga       360
     ttcgctgtcg gcgcagcgtc agccactgtt ccggtgtacc ttgctgaaaa cgcgccaaag       420
     cgcatcaggg ggtcgatcgt ggctatcgac caactcatga tcgtcaccgg tcagctgttg       480
     gcgttctcca tgaacgccat cattaacgcc gctcatggcg gtccgcagtt gatcatcaag       540
     gccaacaaca atccggacag cctcgggatc accaagggca cctattcgtg ggaccagatt       600
     ctggctctcc aggcttcgaa gggcgggccg ctggaggggg accagtaccg cgcgttcgtg       660
     gagaatctcg tcatccagtc tggtaacggt gcggcctggc ggtggatgct ggtgctgtgc       720
     tcaatcccgg ccatcgcgct gtggataggt attcgcctca tgcctgagtc ggctcgttgg       780
     tacttggcca aaggtcgggt ggctgatgct gtcggagctc tcaaacgagt gcgcgatccc       840
     cagaaggatg gtcctctgga tgctgaggtc gaggagatgc ttgtcaccca gcagcgcgag       900
     ttggagaaca agtatcaggg caacgccttt gcccatgtgt ggcgaacgcc gtggctacgc       960
     aaactcatgc tagtaggtat cttccttgca atcgtcaacc agacgacagg cgttaatacc      1020
     gtgatgtatt acgcgccgaa agtactggag tatgccggta tgacgacctc tgcctcgatc      1080
     accgcgcagg tggccaatgg tgtcatgtcc gtcattggtt ctgttggtgg tttgtggctt      1140
     atcctcaagt tcagccggcg tagtttactc attttcgacg tctccgccgt gggcattact      1200
     ttgcttgtca ttgcgggaac cttccagttc acaatcgccc cgcacattgc tgacaagacc      1260
     acgccgccga cgtgggcacc gtacctcatc cttggtctta tggcggtgtt tatgcttatc      1320
     gtgcaatcta ccaatggcac ggtggtgtgg accatgctcg gtgagatgtt cccggcaaac      1380
     gtccgcggca tcatgaatgg cacggccatc ttcttcatgt gggttattaa cgctgtcatc      1440
     accttcacct tcccgtccat gatggcaagt ctgggaggtg ggttgacgta caccatctac      1500
     ggcatgatga atctcgtcat cgcagtagtc ctcttcaaga tcatgcctga gacccgaaat      1560
     aagtccttgg agcagatcga aacgtacatg gaagagcgct actcctga                   1608
//

If you have problems or comments...

PBIL Back to PBIL home page