(data stored in ACNUC30630 zone)

EMBL: CP001977.PE502

CP001977.PE502       Location/Qualifiers
FT   CDS_pept        537387..538196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3512"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3512"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00597"
FT                   /db_xref="GOA:D4HBT4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBT4"
FT                   /protein_id="ADE00597.1"
FT                   /translation="MVILGVGQAGFDLVLTALVGGHPDAQTSTILLLASFAGVWLVLWA
FT                   WMRFVEQRPMSCLGFRGPGSDVWIGVAIAIAILAIDVVVMTVSGQVTMSWARPSIMAAV
FT                   FIVAAILLFLVQGCAEEAVLRGYLMQSVAAKWGIPAGLAIQAVVFAALHGANPGTTWVA
FT                   LVNVTGFGLMQGLLVVWRGNLLAAMGFHTVWNWLQGMVLGFDVSGLELHHSVMTTARTT
FT                   GSHSWLTGGTFGAEGSVINTIVLAILITCLLVTMRHDWRDNEAYGIA"
     atggtcatcc tcggcgtggg acaggctggt tttgacttgg tactcaccgc tctggttggc        60
     ggtcatccag acgctcagac ctcgacgatc ttgttactgg catccttcgc tggtgtctgg       120
     ctggtgttgt gggcgtggat gcggttcgtc gagcagcggc ccatgagctg tcttggtttt       180
     cgcgggcccg gcagtgacgt ctggattggg gtagccatcg cgatcgcaat cctcgctatc       240
     gacgttgtgg tgatgacggt cagcggccag gtgacgatgt cgtgggccag gccgagcatc       300
     atggctgcgg tgttcattgt cgctgcgatc ttgctgtttc tggtgcaggg atgcgctgag       360
     gaggccgtgc tgcgcggcta tcttatgcag tccgtggcag cgaaatgggg gattcctgcc       420
     ggactggcta ttcaagccgt cgtttttgct gcgcttcatg gggctaaccc aggcacaaca       480
     tgggtggcat tagtcaacgt cacagggttc ggcctcatgc agggtctgct ggtggtgtgg       540
     cgaggcaacc tgctcgcggc gatgggtttc cacacagtct ggaattggtt gcaggggatg       600
     gtgttaggat tcgatgtctc gggtctggag cttcaccaca gcgtcatgac gactgctagg       660
     acaactggct cacactcctg gctaactggg ggaaccttcg gggcggaggg atccgtcatt       720
     aacacgattg tcttggctat ccttattact tgccttctcg tgacgatgag gcacgattgg       780
     cgcgacaatg aagcctatgg cattgcttga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page