(data stored in ACNUC30630 zone)

EMBL: CP001977.PE515

CP001977.PE515       Location/Qualifiers
FT   CDS_pept        550074..551060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3525"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01115"
FT                   /db_xref="GOA:D4HBU7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBU7"
FT                   /protein_id="ADE01115.1"
FT                   /translation="MTQRSRTRRRASRAASALLALGCAWGLSVSPAAAADFTVRTDKKL
FT                   GKPVGMAADLHHDWYWITDGSSSTVHSLLAVDKTGKEVHRVVWEPAFHDVEAMSWARGV
FT                   LYVADIGDKKAQRRGIRVMSPTSTAAKQSTYYEWMFTYPDGAHDAKALTVSPKGSFYII
FT                   TDGPHPAIYRGGPQVSRTESNPLEKVADAPAGVKDATFLPDGSRMALLTDHEVRVVDAY
FT                   SWKTVANAAFSGGQAIATDTTQKTLEIATSGNKVRGIKFPTTLTSITPTPSHSPKAKVV
FT                   TPANGKPTSKARSGTFIAVMGAVVVALCAGVVTFFYGRSRDTTWRHR"
     gtgacccaac gatcccgcac ccgacgtcgc gcctcccgag ccgcaagcgc gttgctggcg        60
     ctcggatgcg cttgggggtt gtcggttagt cctgccgcag ctgccgactt caccgtcaga       120
     acggataaaa agctcggcaa acctgtcggt atggctgctg accttcatca tgactggtac       180
     tggatcaccg acggttcttc gtcgacagtc cactctctgc ttgctgtcga caagacgggc       240
     aaagaggttc accgggtggt atgggagcca gccttccatg atgtcgaggc gatgtcgtgg       300
     gctcgtgggg tactgtacgt cgctgacatc ggtgacaaga aagctcagcg tcgtgggatt       360
     cgggtgatgt ctcccacctc aacggcagcc aagcagtcca cctattacga gtggatgttc       420
     acttatccgg acggcgctca cgacgccaaa gccttgaccg tcagccccaa ggggagtttt       480
     tacatcatca ccgacggtcc acatcctgcg atttatcggg gcggccccca ggtgagccgc       540
     accgaatcga acccactaga aaaggtggca gatgcccctg ctggggtcaa agacgccaca       600
     ttcctgccag atgggtcacg aatggccctc ctcactgatc atgaggtgcg cgtcgttgac       660
     gcctactcct ggaagacagt cgccaatgcg gccttctccg gcggtcaggc catcgcgacc       720
     gacaccactc aaaaaactct ggagattgcg acctcaggta acaaagtgag ggggatcaaa       780
     ttcccgacaa ccttgacctc gattacgccg accccgtcac actctccgaa agccaaggtg       840
     gttaccccgg ccaatggcaa accgacgtcc aaggcgcgat caggaacttt tatcgcggtg       900
     atgggggcgg tcgtagtggc gctgtgcgct ggcgtcgtta cgttcttcta cggccgctcc       960
     cgggacacca cctggcggca tcgttag                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page