(data stored in ACNUC30630 zone)

EMBL: CP001977.PE53

CP001977.PE53        Location/Qualifiers
FT   CDS_pept        complement(51031..53502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3053"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3053"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99592"
FT                   /db_xref="GOA:D4HEL1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEL1"
FT                   /protein_id="ADD99592.1"
FT                   /translation="MFTEALRELRHHPGRLVATLIAIAVSVGFLVGISMFVRTQGVALG
FT                   KEQAVATSKADVVVDTGGAVADPDEVTRTIKETQGVAAVDTVLSTSMPAAHGHDSVMID
FT                   LHQVPAEPFRWSTVKDGSWPSKADEVALSEDAAKRLQASIGDTVAFSGHDLKVVGITDD
FT                   PSALQTAPAYVGQLPGQTPDTWVVKAKDGTAPGQLVTNLEKTLPKIKDAPQFNKDDAGA
FT                   TISTADSFQKKTINSLTEDFDVTKYMLMVFGAIALLVGAIIITTTFLILLAQRRRQIGL
FT                   MRAVGASSGQVRRRVLAEAIVLGVLGSMLGVVLGILLTVAGTAYTGALAFGLAWPWGDI
FT                   IVEFLIGIVITVLAAFLPALRATRVAPLEALRPVPTVEQKRRIGIARIVVCSLLAVAGI
FT                   ALSVGAIVGTGTSIITMAILSAMCLSLTLLIATPLYVPWLIRAMGFLLRPLGPTARLST
FT                   SNANRNPTRTSLTAVALMLAIGLSVTLQVGISTTRTTVMDQINEHFPIDLTLTNRPSYD
FT                   PNTGQETASTLDTSALKTVQDLPNVKDSIVLKGGFAESDLSPHAHMLSGNPDEIAKVAP
FT                   SIAKEMKPGVALITSIDNPPQTMTFTSSKGKVTLKVTKVHGLSEGDVVVNQEDLKRIVP
FT                   SVTDQSIWVHLDDRSNLASTLTVMMSMSSSSSQHMDIGGGALIGGIVELILKVLLMVMT
FT                   ALLGVAVLIALIGVANTLSLSVLERRRESALLRAMGMQRRGLRLMLLYESIQVGMAGVI
FT                   VGIVAGFYFAWLGIRSVFRVASDTIPVHFSIDWPWTLSLIAICLVAACLASVLPGRRAA
FT                   KAIPTEALADE"
     atgttcactg aggctctcag agagctgcgt caccatcccg gtcggttggt cgcaaccctc        60
     attgccattg cagtgtcggt tgggttcctc gttggtatct cgatgttcgt acgtacccag       120
     ggtgtggcgc tgggcaagga acaggccgtt gccacctcga aggccgacgt tgtcgtcgac       180
     accggcggag cggttgccga ccccgatgag gtcacccgaa ctatcaaaga aacccagggg       240
     gtcgcggctg ttgacaccgt gctgtcgacg tccatgccgg cagcccacgg acatgattcg       300
     gtgatgatcg acctccacca ggttccggca gagcccttcc gctggtcgac ggtcaaggac       360
     gggtcctggc cgtcgaaggc cgacgaggtc gctctgtccg aagatgctgc caagcgactc       420
     caggccagca tcggcgatac cgttgcgttc agcggtcatg acctcaaggt ggtcggcatc       480
     accgacgacc cctcggctct gcaaactgct ccggcttatg tgggccaact tcccggccaa       540
     acccccgata cctgggtcgt caaggccaag gatgggacgg cgccgggaca actcgtcacc       600
     aacctcgaga agaccctgcc gaagattaag gacgcaccgc agttcaataa agacgacgcc       660
     ggcgccacga tctcgacggc tgactctttc cagaagaaaa ccatcaatag tctgactgag       720
     gacttcgatg tcaccaagta catgcttatg gtctttggtg ctatcgccct gttagtggga       780
     gcgattatta tcacgacgac ctttctcatt ctgttggctc agcgacgtcg ccagatcggc       840
     ctcatgaggg ctgttggagc gtcgagcggc caagtgagac gacgagtcct cgccgaggcg       900
     atcgtgctcg gcgtccttgg atcgatgctg ggggtcgtgc ttggcatcct gttgaccgtt       960
     gccggcacgg cttataccgg ggctttagcc ttcgggttag cctggccgtg gggtgacatt      1020
     atcgtcgagt tcctcatcgg catcgtcatc actgtgttgg cggccttcct gccggcactg      1080
     cgggcaactc gagtggcacc attggaggca ctgcgcccag taccgaccgt ggaacagaaa      1140
     cgtcgcatcg gtattgcgag gatcgtcgtc tgctccctgc ttgcagtggc tggaattgcg      1200
     ctatctgtgg gggccatcgt cggaaccggt acatcaatca tcacgatggc aattctgtca      1260
     gcaatgtgtc tgtctctaac tttgctcatc gcgaccccgc tgtacgtgcc gtggttgatc      1320
     cgtgccatgg gattcctgct gcgacctctc gggcccacag cacggctatc aacctcaaac      1380
     gccaaccgca acccgactcg cacgtctctg actgcggtgg cccttatgtt ggctatcggt      1440
     ttgtcggtga ccttacaggt gggcatctcg acgacgcgca cgacggtcat ggaccaaatc      1500
     aacgagcact tcccgatcga cctcaccctc acgaaccgcc cctcttacga cccaaatacc      1560
     ggccaggaga cggcgagcac gctcgacacg tcagccctaa agacggtgca ggacctgccg      1620
     aacgtcaagg actccatcgt cctcaaaggt gggttcgccg agagtgatct gtcccctcac      1680
     gcccatatgt tgtccggaaa ccctgacgag atcgccaagg tggcaccctc catcgccaag      1740
     gagatgaagc cgggggtcgc actgataact tccatagaca acccgccgca gactatgacc      1800
     ttcacctctt ccaaaggcaa agtgactctc aaggtcacga aggtccacgg gctttctgaa      1860
     ggcgacgtcg tggtcaatca agaggacttg aagaggatcg tgccttccgt gactgaccag      1920
     tccatctggg tccacctgga cgaccgcagc aatttggcct ccactctgac ggtgatgatg      1980
     tccatgtcga gcagtagttc gcagcatatg gacatcggtg gaggcgccct catcggcgga      2040
     atcgtcgagc tgatcctcaa ggtcctgctg atggtgatga cggccctgct cggtgtggcg      2100
     gtgctcatcg ccctcatcgg cgtggccaat accttgagcc tgtccgtgct ggagcggcgt      2160
     cgggaatctg cgctgttgcg ggctatgggc atgcagcggc gtggattgag gttgatgctg      2220
     ctgtacgaat cgatccaggt cggaatggcc ggcgtcatcg tgggaatagt tgctgggttc      2280
     tacttcgcct ggctgggcat tcggtcggtg ttccgcgtcg cctcggacac catccctgtg      2340
     cacttctcga tcgattggcc atggaccctc agtctcatcg cgatctgcct ggtggcggca      2400
     tgcctggcct cggtgttgcc gggcagacga gccgccaaag cgattccaac cgaggcgctc      2460
     gccgacgagt ga                                                          2472
//

If you have problems or comments...

PBIL Back to PBIL home page