(data stored in ACNUC30630 zone)

EMBL: CP001977.PE530

CP001977.PE530       Location/Qualifiers
FT   CDS_pept        563534..564208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3541"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3541"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99306"
FT                   /db_xref="GOA:D4HC08"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC08"
FT                   /protein_id="ADD99306.1"
FT                   /translation="MPRHHHWPVTMQAGGVVLRPMRRADEARWTTTRELDWDWLGPWEA
FT                   TKPPGSHERVGGYRMMITRNRRRAKEGTFLPWAIGWDDGWPDRPALNRDTTPLIGQLTV
FT                   SSISLGSAMSCSMGYWVASAYAGRGVAPTAVALACDYVFQVMGLHRVEICVRPENTKSL
FT                   RVVEKLGLAEEGMRPAYLHIDGQWRDHRVFRLLTDDYPDGVLRNYLVNHLLPGFALEED
FT                   EG"
     atgccgcggc atcaccactg gccagtgact atgcaggctg gcggggttgt gctgcgcccg        60
     atgcggcgtg ctgacgaggc gaggtggacg acgacacggg agctcgattg ggactggcta       120
     ggcccgtggg aggccaccaa gcctcctggc tctcatgagc gggttggcgg ctaccgcatg       180
     atgattaccc gaaatcgccg gcgtgccaaa gaaggcacat ttttgccgtg ggcgattggg       240
     tgggatgatg gttggcccga tcgtcctgcc ctgaaccgag acactacgcc ccttatcggg       300
     caattgacgg tgtcgtcgat ttcgttggga tctgcgatgt cgtgctcaat gggctattgg       360
     gtggcttccg cctacgccgg taggggggtt gcaccgaccg cggtggcgtt ggcgtgcgat       420
     tacgtctttc aggttatggg attgcaccgc gtcgagatct gcgtgcggcc agagaacacg       480
     aagagtttgc gcgtcgttga aaaacttggc ctggcagagg aggggatgcg gccggcatac       540
     ttgcatatcg atggtcagtg gcgcgaccat cgtgtgttcc gcttattaac tgacgattat       600
     cccgacggag tgctgcgcaa ctacctggtc aaccaccttc ttcccgggtt tgcgctggag       660
     gaggacgagg gctga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page