(data stored in ACNUC30630 zone)

EMBL: CP001977.PE552

CP001977.PE552       Location/Qualifiers
FT   CDS_pept        complement(586026..588605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3564"
FT                   /product="anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family"
FT                   /note="identified by match to protein family HMM PF00384;
FT                   match to protein family HMM PF01568; match to protein
FT                   family HMM PF04879; match to protein family HMM TIGR01409;
FT                   match to protein family HMM TIGR02166"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3564"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99423"
FT                   /db_xref="GOA:D4HC30"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC30"
FT                   /protein_id="ADD99423.1"
FT                   /translation="MSGGLNVESYSTNIPGLKTKASRREFMKWSAVVGGTAALAPVLHE
FT                   TKDALANKPTNDASTFVWSACTVNCGSRCPLRLEVKDGTIVRVLPDDSANNKVGSQQVR
FT                   ACVRGRSIRHRIYNPDRLKKPMKRKPGTKRGDEQWVTISWDQALDEIAEKMKKIKARYG
FT                   NEAFYINYGTGTLGSVMAKSWPPDQSAFARLMNTWGGYLDHYSDYSTTEITQAYPYFYG
FT                   SWVGSNSFDDVKNSKLQVMFGNNPAETRMSGGGQVFVSQQTRKASGVRTIVIDPRYSET
FT                   AITMADEWIPIRPGTDAALVAGLIHTMITEDLHNQAFLDHYCVGFDDKHLPEGTSAGSS
FT                   YRAYLEGKGPDHTIKNAQWASHITGVPAERIRRLAREIAAANPCAITQGWGPQRHANGE
FT                   NSARAIFLLAAVTGNIGIPGGGTGAREGAQAFQFTLPFNTEITNTKSNKIIPVFSWLDA
FT                   IDHGEQMDTFNSGVCEKPAPGVRANKVPIDEHGKPTNVKLSAPIKMVWQYAGNSLVGQT
FT                   GNNNRSVEILRDDSKCELIVVCDIQYTTSARYADYVLPGTSTAEEEDIHPGENGGPMAY
FT                   GIVSSQAIKPLYECRNIFDICAGLAKRLGTEKEFTGGLTRSQWLERTIEETRKKDPGLP
FT                   TYREWKKIGIFRKDMGPYVELDEFRKDPVANPLETPSGKIEIYSERLAAMSEAWTFGTF
FT                   RKKLAGDKLTALPEYVVTWEGPEEAKASKKYPFQVIGHHFKGRTHSSYGNVDWLLDAHP
FT                   QTVWINTRDARAKGITNGDQVFVYNDRGTIRLPARVTDRIAPGVLSVPQGAWYRPLSNT
FT                   KVAPPSKANPKQPVDINGAMNTLTSLHPSPLAKGNAVHTTIANVEKA"
     atgtcgggag gtctcaacgt ggaatcctat tcgacgaata tacctgggct aaagaccaag        60
     gcaagtcgcc gtgaattcat gaaatggtcc gccgtggtcg gcgggactgc cgccctcgcc       120
     ccagtattac acgagacgaa agatgcacta gccaacaagc caaccaacga cgcttcgacc       180
     ttcgtgtggt ctgcttgcac cgtcaattgc ggctcacgct gtccgctgcg cctggaagtc       240
     aaggacggca ccatcgtacg cgtgctaccc gacgatagcg caaacaacaa agtgggctcc       300
     caacaagtac gtgcctgcgt gcgaggacgt tcgattcgcc accgcattta caatcccgac       360
     cgattaaaga agccaatgaa acgcaagccc ggcaccaagc ggggagatga acaatgggta       420
     acgatcagtt gggatcaagc cctcgacgag atcgccgaaa aaatgaaaaa gatcaaagcc       480
     aggtacggca acgaagcctt ttacattaac tacggcactg gcactttagg ctcagtgatg       540
     gccaagtcat ggccgccgga tcagagcgcc ttcgcccggc tcatgaacac gtggggaggt       600
     tacctcgacc attacagtga ctactcgacc accgagataa ctcaggccta cccgtatttc       660
     tacggatcat gggtcggaag caactcattt gatgacgtga aaaactccaa acttcaggtc       720
     atgtttggca acaaccctgc ggaaacacgc atgtcaggcg gcggccaagt gttcgtttcc       780
     cagcagacac gcaaggcctc gggtgtacgc acgatagtca tcgacccgcg ctactctgaa       840
     acggccatta ctatggctga cgaatggatt ccgattcggc ccggcaccga tgccgccttg       900
     gtcgcaggtc tcatccatac catgatcacc gaggacctgc acaaccaagc tttccttgat       960
     cactactgcg tcggtttcga tgacaaacat ctacccgaag gaacatcagc cggttcatct      1020
     taccgagcct atctggaggg gaagggaccc gaccatacca tcaagaacgc ccaatgggcc      1080
     tcccacatca ccggagtccc ggcagagcgg atccgccggt tagcacgtga gatcgcagca      1140
     gccaatccct gcgccatcac ccaaggctgg gggccccagc gtcatgccaa cggagaaaat      1200
     agtgctcggg cgatcttcct gctcgcagcc gtcaccggca acattggcat ccccggcggc      1260
     ggaaccggtg ctcgcgaagg cgcccaagcc ttccagttca ccttgccctt caacactgag      1320
     atcaccaata ccaaatccaa caagatcatc ccagtgttct cttggctgga cgccatcgac      1380
     catggtgagc agatggacac cttcaactct ggggtgtgtg aaaagccagc ccccggagta      1440
     cgtgccaaca aggttcccat cgacgagcac ggcaagccga cgaatgtcaa gctcagcgcc      1500
     cccatcaaga tggtgtggca gtacgcgggc aactcgctag tgggacagac cggcaacaac      1560
     aaccgctcag tggagatcct gcgtgacgat tccaaatgcg agctcatcgt cgtttgtgac      1620
     atccagtaca cgacctcggc ccgctacgcc gactacgtcc tgcctggcac ctccaccgcc      1680
     gaggaagaag acatccatcc aggcgagaac ggggggccga tggcctatgg aatcgtttca      1740
     tctcaggcaa tcaagccttt gtacgagtgc cgcaacatct tcgacatctg cgccggacta      1800
     gccaagcgcc taggcaccga gaaggaattt accggcggat tgacccgtag ccaatggctg      1860
     gaacgcacga tcgaagagac tcgaaagaaa gaccccggcc tgcccaccta ccgcgagtgg      1920
     aagaaaatag gtatcttccg caaagacatg ggcccctatg tagaacttga tgaattccgt      1980
     aaagacccgg ttgccaatcc actagagacc ccctcaggca agatcgagat ttattctgag      2040
     cggctagctg cgatgtccga agcgtggacg ttcggcacct tccgcaagaa gctggctggt      2100
     gacaaactca ctgcactgcc ggaatacgtc gtcacctggg aaggccccga ggaggccaaa      2160
     gcctccaaga aatatccgtt ccaggtgata ggacaccatt tcaaaggacg aacccactcc      2220
     agctatggca atgttgactg gctactggac gctcatcccc agactgtctg gatcaacact      2280
     cgagatgccc gagctaaagg tatcaccaat ggcgatcaag tctttgttta caacgaccgc      2340
     ggtaccatcc ggctaccggc ccgtgtcacc gatcgtattg cacccggcgt tctctcagtg      2400
     ccgcagggcg cttggtaccg ccccttgagc aacacaaagg tcgccccgcc aagcaaggcc      2460
     aatcccaagc aaccggtcga catcaatgga gccatgaata ctctcacctc gctgcacccc      2520
     tcgccgctag cgaagggtaa tgcggtgcac acaacgatcg ccaatgtgga gaaagcatga      2580
//

If you have problems or comments...

PBIL Back to PBIL home page