(data stored in ACNUC30630 zone)

EMBL: CP001977.PE560

CP001977.PE560       Location/Qualifiers
FT   CDS_pept        complement(594765..596327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3573"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase"
FT                   /EC_number="2.4.1.109"
FT                   /note="identified by match to protein family HMM PF02366"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3573"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99366"
FT                   /db_xref="GOA:D4HC38"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC38"
FT                   /protein_id="ADD99366.1"
FT                   /translation="MSTIERLDDGRMTDEYTSWIITALITTVAFVLRVWNVGFPNSLVF
FT                   DETYYPKDAWTMLHQGYEATWPDAAKANADIVRGITNTWTPDAEFVVHPPVGKWLIATG
FT                   EQLFGFNSFGWRFSSVVFGSLLVLMTIRLARRLSRSTMVGAIAGILLTLDGLAFVMSRI
FT                   GLLDIFQAFFLVAGVSAVAADRDWFRHRLADHLRTIGNPHLNGDFGPALGWRPWRLVAG
FT                   IMFGLACGTKWNSMFVLATMGIVSVIWDWSARRLAGAGTKAWWSFLRDGVPAFVYLVVV
FT                   ALLTYLATWAKWLVTYPHMVFGKSWAGPAPSPGLSKVVGKPLAALWEYHRQIYDFHTGS
FT                   YMMTQTHVYASNPSGWLVIQRPLGVDAVNGIKPGQQGCKAVGDTCLRVISATGTPVLWW
FT                   FAAIALVAAVIWWIFARDWRFTLPIVAMMSTWIPWFRYDDRPLFFFYAICIIPFTVTIL
FT                   AIWLGQILGPAKASSRRRIGAIVVGTVMALVAADFAFIYPILTDGLMTRKAWLARMWFH
FT                   SWI"
     ttgtcgacca tcgaacgcct cgacgacggt cggatgaccg acgagtacac gagctggatc        60
     atcacggccc ttatcaccac cgtggcattc gtgctgcgcg tatggaacgt cggattcccc       120
     aacagtctcg tcttcgatga gacctactac cccaaggacg cctggacgat gctccatcaa       180
     gggtacgagg ccacttggcc cgacgccgcc aaggccaatg ccgatatcgt ccgtgggatc       240
     acgaatacct ggactccaga cgccgagttc gtcgtccatc caccagtcgg caaatggctc       300
     atcgcgaccg gggagcagtt gttcggattt aactcctttg gatggcggtt cagctcggtg       360
     gtctttggat cactcctcgt cctcatgacg atccggctgg ctcgacgtct ctcccgttca       420
     accatggtgg gcgccattgc cggtatcttg ctcacgctcg acggcttggc cttcgtcatg       480
     agtcggattg gactgctcga cattttccag gccttcttct tggtggcagg tgtatccgcg       540
     gtagcggccg accgagactg gttccgtcac cgactagctg atcatttgcg caccataggt       600
     aacccacatc tcaatgggga tttcggcccc gctctggggt ggcgaccctg gcgtctggtc       660
     gcaggcatca tgttcgggct ggcttgtggc acgaagtgga actccatgtt cgtgctagca       720
     accatgggta tcgtctctgt catctgggac tggtcggcac gtcgtctagc cggcgccggg       780
     acgaaagcgt ggtggtcctt ccttcgcgac ggggtgccgg cttttgtgta cctcgtcgtc       840
     gttgcgctgt tgacatacct cgccacctgg gcgaagtggt tggtcaccta cccgcacatg       900
     gttttcggta agtcgtgggc tggccccgcc cccagcccag gcctgtcgaa ggtagttggg       960
     aaaccattgg ccgcgctgtg ggagtaccac cgacagattt acgactttca caccggttcg      1020
     tacatgatga cgcaaactca cgtctatgcc tcgaatccgt cgggatggct ggtgatccag      1080
     cgtccactgg gcgtcgacgc cgtcaacggc atcaagcccg gccagcaagg ttgcaaggcc      1140
     gtcggcgata cttgcttgcg cgtcatctct gccaccggga ccccggtact gtggtggttc      1200
     gcggccatcg ccctggtggc tgcggtgatc tggtggatct tcgcccgtga ctggcgattc      1260
     accttgccca ttgtcgccat gatgtcgacg tggatcccgt ggttccgtta cgacgaccgc      1320
     ccgttgttct tcttctacgc gatctgcatc atcccgttca ccgtgacgat cctggctatc      1380
     tggctcggtc agatcctcgg acccgctaaa gccagcagcc gacgacgcat cggtgcgatc      1440
     gtcgttggga cggttatggc tctggtcgcc gccgactttg ctttcatcta tccgatcctc      1500
     accgacggtc tcatgacccg aaaggcatgg ctggcaagaa tgtggttcca ctcctggatc      1560
     taa                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page