(data stored in ACNUC30630 zone)

EMBL: CP001977.PE572

CP001977.PE572       Location/Qualifiers
FT   CDS_pept        606602..607219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3586"
FT                   /product="ribosomal protein L25, Ctc-form"
FT                   /note="identified by match to protein family HMM PF01386;
FT                   match to protein family HMM TIGR00731"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3586"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00777"
FT                   /db_xref="GOA:D4HC50"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC50"
FT                   /protein_id="ADE00777.1"
FT                   /translation="MADIIHLKAEQRTEFGKGAARRIRRDDKVPAVMYGHDHDPIHVTL
FT                   DGHATLLALRTENPLLSIEIEGQKPMLALPKDVQRDVLKGFVRHVDLLTVRRGEKVDVN
FT                   VALRITGESAPGTIAMTEFNEIEVQADLLNIPEVIEIDVTGLEAGTTIYLGDLKLPEGT
FT                   SLLGDAEDVAATVAFPETEPVEDEESAGEDAQGESEEKAAKE"
     atggcagaca tcattcacct caaggcagag cagcgtaccg agttcggtaa gggcgccgcg        60
     cgtcgtatcc ggcgtgatga caaggttccc gccgtgatgt acggccacga tcacgatccg       120
     atccacgtga cccttgacgg ccacgccacg ttgctggctc tgcgtaccga gaatccgctg       180
     ctctcgattg agatcgaggg ccagaaacct atgctcgctc tgccgaagga cgttcagcgc       240
     gacgtcctta agggatttgt ccgccacgtc gacctgctga ctgtgcgtcg tggcgagaag       300
     gttgacgtga atgtcgccct gcgcatcacc ggtgagtctg cccccggcac catcgctatg       360
     accgagttca atgagatcga ggtccaggct gacctcctca atatccccga ggttattgag       420
     atcgacgtca ccggtcttga ggccggcacg actatttacc ttggcgacct caagctcccc       480
     gagggcacta gcctgctagg cgatgcagag gatgttgctg ccactgtcgc cttcccggag       540
     actgagcccg ttgaagatga agagtccgcg ggggaggacg ctcagggcga gtccgaggag       600
     aaggctgcga aagagtga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page