(data stored in ACNUC30630 zone)

EMBL: CP001977.PE580

CP001977.PE580       Location/Qualifiers
FT   CDS_pept        615176..615691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3594"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99065"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC58"
FT                   /protein_id="ADD99065.1"
FT                   /translation="MTMRRRLGAAAVAVALVSVASGCASSPSNAATVGNTTVTMKSVDD
FT                   AVEHCSKFINPSSELTPRQIIASTVIRGAVAQEVLDKRGAKLSDAERDQIVARNGMAAL
FT                   DSDQVCHTMVRSFAGVFHLFDLEGDRKAKADLSAVDVKANPRLGSWDANNLVVQGSSSL
FT                   SQPFTKTS"
     atgacgatgc gacgacgact cggtgccgct gcggtggctg ttgctctggt gagtgtggct        60
     tccgggtgtg cgagttcccc gagcaacgcg gccacggtgg gaaatacgac ggtgaccatg       120
     aagtccgttg acgatgccgt cgagcattgc tcgaagttca tcaacccgtc ctcggaactc       180
     accccgcgcc agatcatcgc ctcgacggtt attcgtggag ccgttgcgca agaggtcctg       240
     gacaaacgcg gagcgaagct ctctgacgcc gaacgtgacc agattgtcgc tcgaaatggt       300
     atggctgcct tagattccga tcaggtctgt cacacgatgg ttcgtagctt cgcgggtgtg       360
     ttccatcttt tcgacctcga gggtgacagg aaggcgaagg ctgacctgtc cgccgtcgat       420
     gtgaaggcca acccacgcct agggtcctgg gacgctaaca acctggtcgt tcagggcagc       480
     tcgtcgctgt cccagccctt cactaagact tcctga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page