(data stored in ACNUC30630 zone)

EMBL: CP001977.PE582

CP001977.PE582       Location/Qualifiers
FT   CDS_pept        616454..616984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3596"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00069"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC60"
FT                   /protein_id="ADE00069.1"
FT                   /translation="MRRALAALFAAVVALGALSGCKGSANDPAGVTEVSDAPTASVPSV
FT                   SQSSGPKPTPQDVNPNTKLTATPQRGGLKDFLPGVTGIISDRVVTGSTSQTVVVKAGTV
FT                   TDYYFLCDTTDALMSVTENDESTASTPCHEGFAHLSVGKRAQSGQIELHIDAPENVTYE
FT                   FVITENPAEDQRQ"
     atgcgacgag ccctggcagc gctgtttgcc gccgtcgtcg ccttgggggc gctgtctggc        60
     tgcaagggca gcgcgaacga cccggctggc gtcactgagg tttcggatgc gcctacagct       120
     tccgtgccgt cggtgagtca atcctccgga cctaaaccga ccccgcagga tgtgaatccg       180
     aacaccaagt tgacggcaac cccgcagcga ggtgggctga aggactttct tcccggcgtc       240
     actgggataa ttagtgatcg tgtcgtcacg ggctccacgt cccagaccgt cgtcgtcaag       300
     gctggcaccg tcaccgacta ctactttctg tgtgatacca ccgatgcgct gatgagcgtc       360
     accgaaaatg acgagtcgac ggcatcgacc ccgtgccatg agggattcgc ccatctgagc       420
     gttggtaagc gggcacagag cgggcagatc gagctacata tcgacgcacc tgagaacgtc       480
     acgtacgaat tcgtcatcac tgaaaaccca gcggaggatc aacggcagtg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page