(data stored in ACNUC30630 zone)

EMBL: CP001977.PE586

CP001977.PE586       Location/Qualifiers
FT   CDS_pept        619639..620571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3600"
FT                   /product="Ppx/GppA phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF02541"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3600"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01120"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC64"
FT                   /protein_id="ADE01120.1"
FT                   /translation="MSGSHTVAAIDCGTNSIRLLIASADSDGRLVEQARELEMVRLGQG
FT                   VDATGSFRPDALERTFSACRTFAQAIADHHCDRVRFVATSAARDVSNRDAFFAGVRQAL
FT                   GVDAEVIDGMEEASLSFAGAISGIQVIDEPVLVIDCGGGSTELVLGRGSSIDSRVSLNI
FT                   GSVRLRERFLHDDPPTVEQIDDARKYVREALDSCPVDVAAARTVIGVAGTVTSLSAIGQ
FT                   NLTDYDRAKVHRSVLTVGQISDLAGKLLSSTVDEVEQMGPLKRRRAEVLCGGAVIIDEV
FT                   CRRATAGKLVVSETDILDGMALAMLAQGS"
     atgagcggca gccacaccgt tgcagctatc gactgcggga cgaattcgat tcgcctcctc        60
     atcgcatcag ccgattcgga cgggcgtttg gtcgagcagg cacgagaact ggaaatggtg       120
     aggctcggtc agggggttga cgccaccggt tccttccgtc ccgacgccct tgagcgcact       180
     ttctcagcct gtcgcacctt cgcccaggct atcgcggacc accactgcga ccgggtgcgt       240
     tttgttgcca cctcggctgc tcgtgacgtc tccaaccgcg atgccttttt cgcgggagtc       300
     cgtcaagctc tgggggtgga cgcggaggtc atagacggca tggaagaggc gagtttgtct       360
     tttgctggag cgatttctgg gatccaggta atcgatgagc cggttcttgt tattgattgt       420
     ggaggtggct cgacggagct ggtgctgggc cgtgggtcta gcatcgactc tcgggtgagc       480
     ctcaatattg gctcggtacg gctgcgtgag cgtttcctcc atgacgaccc gcccaccgtc       540
     gagcagatcg acgacgctcg caagtacgtt cgtgaagcct tggattcctg cccggttgac       600
     gttgccgccg cccgtaccgt catcggcgtt gcgggtacgg tcacgagctt gtccgcaatt       660
     ggccagaatc tcacagatta tgaccgcgcc aaggtgcatc gttcggtact gacggtcggc       720
     cagatttccg acctggcggg caagttgctc tcgtctactg ttgatgaagt cgagcagatg       780
     ggaccgctga agcgacgccg tgcagaagtg ttgtgtggag gtgccgttat tattgacgag       840
     gtatgccgtc gtgcgacggc aggtaaactt gtcgtctcgg agaccgatat ccttgacggc       900
     atggcgctgg caatgctggc gcaggggagc tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page