(data stored in ACNUC30630 zone)

EMBL: CP001977.PE593

CP001977.PE593       Location/Qualifiers
FT   CDS_pept        630710..632698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3613"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="identified by match to protein family HMM PF03169;
FT                   match to protein family HMM TIGR00728; match to protein
FT                   family HMM TIGR00733"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3613"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99508"
FT                   /db_xref="GOA:D4HC71"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC71"
FT                   /protein_id="ADD99508.1"
FT                   /translation="MSDLSSSSAPARRPGTSVRELTFRGIVLGGLMTLIFTAANVYLGL
FT                   KVGLTFATSIPAAVISMAVLRHFKGHSVEENNIVQTIASAAGTLSAIIFVLPGLIMVGW
FT                   WSGFPYWTTLAICLVGGILGVMYSIPLRRALVTGSDLPYPEGVAGAEVLKVGDSAGAAE
FT                   ANKVGLRVIIVGSVVSAAYALLSDLKLVKSALTKPFKTGDSSGSMVGVSMSMALIGVGH
FT                   LVGIAVAAAILVGLFISYGAILPWRVSGKVGSDLTVIQDVFTSDVRFVGAGTIGVAAIW
FT                   TLVKVIGPIVKGISDSISSSKTRHEGGEVPLTERDLPVSVVLTVVLISMIPIGFMLWGF
FT                   ARDMVVSRSMTGVIIVSLAFILLVGLAVASVCGYMAGLIGASNSPISGVGILVVLVAAL
FT                   LIKLTYGAVGGGETVKLVAYTLFTASIVFGIATISNDNLQDLKTGQLVGSTPWKQQIAL
FT                   IIGVIFGSAIIPPVMQLMQSAFGFQGAPGAGPNALQAPQATLISSLATGVFGGALDWGL
FT                   MGIGALVGIGVIVVDEILTHTTKKFSLPPLAVGMGMYLPMTLSLTIPIGAALGWLFDKW
FT                   AAHTAGDVEGKKRTGILLATGLIVGESIFGVIYAAMIAAAGSEDAIAIAPESWDSGAGI
FT                   VGVITFAAAIAFLYRWTKRQAKERVEA"
     atgtctgacc tatcgagctc gtcagcgccg gcccgacggc cgggaacctc agtacgtgaa        60
     ttgaccttcc gaggcatcgt cctcggtggc ctcatgacgt tgattttcac cgcggcgaat       120
     gtttacctcg ggctcaaggt cggtttgacc ttcgccacgt ctattcctgc tgccgtcatc       180
     tcgatggccg tgctgcgtca cttcaaggga cactcggtcg aagagaacaa cattgtccag       240
     acgatcgcgt cggcggccgg caccctctcc gcgattattt tcgtgctgcc cggacttatc       300
     atggtcggct ggtggtcagg tttcccgtac tggaccaccc tagctatctg tctagttggc       360
     ggcatcctcg gcgttatgta ttcgattccg ctgcgtcggg ccctcgtgac aggctcggat       420
     cttccctacc cggagggcgt cgcaggagct gaggtgctca aagtaggcga ttccgctggt       480
     gccgccgagg ctaacaaggt gggtctgcga gtcatcatcg tcggttctgt ggtctctgca       540
     gcgtacgccc tgttgtcgga tcttaagctt gtgaagtcgg cgctgaccaa gcctttcaag       600
     acgggcgaca gtagcggctc gatggttggc gtgagcatgt cgatggcgct cattggcgtc       660
     ggtcacttgg ttggtattgc cgtggccgcg gccatcctcg tcggtctctt tatttcgtac       720
     ggtgcgatcc tgccgtggcg ggtatccggc aaagttggta gcgaccttac ggtgattcag       780
     gacgtcttca ctagcgatgt ccgcttcgtc ggtgctggca ccatcggtgt tgcggctatc       840
     tggactcttg tcaaggtcat tggccccatc gtcaagggca tcagcgattc cataagttcc       900
     tccaagacac gtcacgaggg cggcgaagtc ccactgaccg agcgtgacct accggtttct       960
     gttgtcctca ccgtggtgtt gatctcgatg atcccgatcg gtttcatgct gtggggattt      1020
     gctcgcgaca tggttgtatc gcggtccatg accggcgtca tcatcgtcag cttggcgttc      1080
     atcctgctcg tcggtctggc tgttgcttct gtgtgcggtt acatggctgg tctcatcggt      1140
     gcatccaata gcccgatttc cggcgttggc atcctggtcg tcctggtggc tgctctcctc      1200
     atcaaactca cctatggtgc tgttggtggt ggtgagacgg ttaagctggt ggcctatacc      1260
     ctgtttaccg catccatcgt ctttggtatc gcgacgatct cgaatgacaa cctgcaggac      1320
     ctcaagactg gtcagttggt tggttcgacg ccgtggaaac agcagattgc gctgatcatc      1380
     ggagttattt ttggttcggc gatcatcccg cccgtcatgc agctcatgca gagcgccttt      1440
     ggtttccagg gtgcccccgg tgctggtccg aacgctttgc aagccccaca agctaccctt      1500
     atttcctcgc tggcgactgg cgtcttcggc ggggctcttg actggggact catggggatt      1560
     ggtgccctgg tgggtatcgg cgttatcgtc gtcgacgaga tcctcactca caccaccaag      1620
     aagttctccc ttccgccgct agccgtcggg atgggcatgt acttgccgat gaccctgtct      1680
     ttgacgattc cgattggcgc cgcgcttggc tggctgttcg acaagtgggc ggcccacacc      1740
     gccggtgatg tcgaaggtaa aaagcggacc ggaatcttgc tggccacggg cctcatcgtc      1800
     ggtgagtcaa tcttcggtgt catctatgct gccatgatcg cggccgcggg atccgaggac      1860
     gccattgcca tcgcgcctga gtcatgggac agcggcgctg ggatcgttgg cgtgatcacc      1920
     ttcgccgctg caatcgcgtt cctgtaccgg tggaccaagc gccaggcgaa agagcgcgtc      1980
     gaagcgtga                                                              1989
//

If you have problems or comments...

PBIL Back to PBIL home page