(data stored in ACNUC30630 zone)

EMBL: CP001977.PE594

CP001977.PE594       Location/Qualifiers
FT   CDS_pept        complement(632741..633604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3614"
FT                   /product="oxidoreductase, aldo/keto reductase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3614"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99917"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC72"
FT                   /protein_id="ADD99917.1"
FT                   /translation="MKYRQIGPFRTSAIAYGSMPLSIEGRPDRETAINILHDVLDAGCT
FT                   HIDTAWAYYESGGVEQYGERLVTDALASWDGDHSTISVATKVGHFRCFNDAGQPVWDVD
FT                   GSPERLRRDAKLSAEALRTDQIDLLYLHRPDPKVEYEGMVRTLAGILDDGLARTAGISN
FT                   ANPDQIRLAHSILGDRLVAVQNQFSPGFLSSRPELELCGELGLAFVAWSPLGGYRRPLD
FT                   EDAFAAFQRIADARGISRAQVILAWELSKGPHVIPIPGSHRSQTILDSLRSVDVTLNDE
FT                   ELAQLP"
     atgaagtacc gccagatcgg accattccgt acgtcagcaa ttgcctacgg ctcgatgccg        60
     ctgtctattg agggccgtcc cgaccgcgag accgcgatca acatcctcca tgacgtcctc       120
     gacgcgggat gcacccacat tgacaccgct tgggcctatt acgagtcagg aggcgtggag       180
     cagtacggcg aaaggctcgt caccgatgcc ttggcgtcat gggatggtga ccattcgaca       240
     atctcggtgg ccactaaagt cgggcacttt cgctgtttca acgacgccgg gcaacccgtc       300
     tgggatgttg atgggtcacc ggaacgactg cgtcgcgacg cgaagctctc ggctgaggca       360
     ttgcgtaccg accagatcga tctattgtat ttgcatcgcc ctgaccccaa ggtcgaatac       420
     gaaggcatgg tgcggactct ggccggaatc ctcgacgacg gtttggcgcg taccgcaggc       480
     atctctaatg ccaatcccga ccagattcga ctggcccaca gcatcctcgg tgatcgtctc       540
     gtggcggtgc agaaccagtt ctccccagga tttctatcct cgcgtccgga actggagcta       600
     tgcggcgaac tcggcctagc cttcgtcgcg tggagcccgc tgggcgggta tcgtcgtccc       660
     ctcgacgagg acgcattcgc ggccttccag cgcatcgccg acgcccgtgg catcagccgg       720
     gcacaggtca tccttgcttg ggagctgagc aagggcccgc acgtcatccc gattcccggg       780
     tcccaccgtt cccagacgat tcttgattcc ctcaggtccg tcgacgtcac gctgaacgac       840
     gaggagcttg cccagcttcc gtga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page