(data stored in ACNUC30630 zone)

EMBL: CP001977.PE596

CP001977.PE596       Location/Qualifiers
FT   CDS_pept        634508..636127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3616"
FT                   /product="Sodium:neurotransmitter symporter family protein"
FT                   /note="identified by match to protein family HMM PF00209"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3616"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00306"
FT                   /db_xref="GOA:D4HC74"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC74"
FT                   /protein_id="ADE00306.1"
FT                   /translation="MSDPAQSGATVAGGGRATRKPQRRESFAGRGAFLIAAIGSAVGLG
FT                   NIWRFPYVAYSNGGGAFIVPYLVALLTAGIPLLFLDYAVGHKFRGSPPMALRRLHRRME
FT                   AIGWWQTLICWVIVIYYAVIIAWAIRYVGFSVTKTWGHDPEGFLTGSFLHVASNVDVEF
FT                   HFVSGVFWPLLLLWLFVLAIMATGVEKGITRASWIFMPLLAVMFITLVIVALTLDGASV
FT                   GLNALFTPSWGALGNYRVWMAAYGQIFFSLSVGFGIMVTYASYLKPKSDLTGSGLVVGF
FT                   ANSSFEILAGLGVFAALGFMATASGKPVSEVAGSGIGLAFIAFPQIISQAGAVGPILGV
FT                   LFFVSLVFAGITSMISLLEVVIAAFREKTGISRKAATWIIGGVTAIASIVLFPTTTGLN
FT                   LLDVTDHFINNIGIVGVALLACLVISWALRKLPVLRDHLNEYSSFQVNKVWMALVSVVA
FT                   PLVLLSLWITEIITVASKGYGEMPRNFVGIFGWGMSILVVVLAIVLSLIPWPHRSAIHH
FT                   ELTHEEELACENFQETEEGALS"
     atgtctgacc ctgcgcagtc cggcgcaacc gtcgcaggtg gggggagagc cactcgaaag        60
     ccccagcggc gtgagagttt cgccggccga ggcgcctttc tcatcgctgc gatcggttct       120
     gcggtcggct tgggcaatat ctggaggttc ccttatgtcg cctatagcaa tggtggtgga       180
     gccttcatcg tgccttatct ggtagcgctg ctcaccgctg gtattccgtt gctcttcctc       240
     gactacgccg tcgggcataa gttccggggc tctccgccga tggctctacg ccgtctccac       300
     aggcgcatgg aggccatcgg gtggtggcag accctcatct gttgggtgat cgtcatctac       360
     tatgcggtca tcattgcctg ggccattcgc tatgtcgggt tctctgtgac gaaaacgtgg       420
     ggacacgacc cggaggggtt ccttacgggc agcttcctgc acgtggctag caacgttgac       480
     gtcgagttcc acttcgtgtc tggagtgttc tggccattgt tgttgctatg gctttttgtg       540
     cttgccatca tggctaccgg cgtcgagaag ggcattaccc gggcatcgtg gatctttatg       600
     ccgctgctcg cggtgatgtt cattactctg gttatcgtcg ctcttaccct tgacggggcc       660
     tcggttggac ttaatgcatt gttcaccccg tcgtggggtg cgctgggcaa ctatcgggtg       720
     tggatggcgg cttacggtca gatctttttc tcgctatcgg tggggttcgg gatcatggtg       780
     acctacgcct cctacctcaa gccgaagtct gacctgacag gatctggcct ggtcgtcgga       840
     tttgcgaact cttcgttcga aatcctcgcg ggcctcggcg tcttcgctgc tctgggattt       900
     atggcgaccg cttccggtaa gccggtgagt gaggtcgccg gctcgggtat tggcctggcc       960
     ttcatcgctt tcccacagat catcagccag gccggtgctg tcggaccaat tctgggagtg      1020
     ctgttcttcg tctccctggt cttcgccggc atcacctcaa tgatcagctt gctcgaggtc      1080
     gtcatcgctg ctttccgaga aaagacgggt atctcacgta aagctgcgac ctggattatt      1140
     ggcggtgtga cggcgattgc gtcgatcgtg ttgtttccga cgacgactgg tctcaatctg      1200
     ctcgacgtta ccgaccactt catcaacaac atcggcatcg ttggggttgc cctgctcgca      1260
     tgcctcgtca tttcctgggc gctgcggaag ctgccggtgt tgcgcgatca cctcaacgag      1320
     tactcctcgt tccaggtcaa caaggtgtgg atggccctgg tcagtgttgt cgccccgctg      1380
     gtcttgctga gcctgtggat cacggagatc atcactgtcg cgagtaaggg atatggcgaa      1440
     atgcccagaa acttcgttgg gatcttcggc tggggaatgt ccatcctcgt cgtcgttctg      1500
     gcgatagtgc tgtcactcat cccgtggcca catcgctcgg cgattcatca tgagcttacc      1560
     cacgaggagg agctggcctg cgaaaacttc caagaaaccg aggaaggagc cctgtcatga      1620
//

If you have problems or comments...

PBIL Back to PBIL home page