(data stored in ACNUC30630 zone)

EMBL: CP001977.PE75

CP001977.PE75        Location/Qualifiers
FT   CDS_pept        81422..82219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3075"
FT                   /product="methyltransferase domain protein"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3075"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00407"
FT                   /db_xref="GOA:D4HEN3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEN3"
FT                   /protein_id="ADE00407.1"
FT                   /translation="MEIIDYFGLWEHDRSCDPQRRTLEEEREFWRCYARVYDQHAGETG
FT                   GSLAQIAAVTEIVEPGSSVLDVGGGTGRFAIPLAQRGCRVTVLDRSEDMLSVLESSAEE
FT                   KDVEIDVVHQEWPADLGCQFDSVIAAWSLYWNLDLQASLQAMVRQTKKHLIIIDTTGSP
FT                   TVWDHALAVARGGGIVASQARHLLFAGGLAQLGIPAEIRVLEEYRVIGETELEREIDAH
FT                   GGSKVAAMEYLDTHAVRIRSGWRYKRTVGLIHAQGKNIPARNL"
     atggagatca ttgattactt cgggctgtgg gagcatgaca ggagctgtga tccccaacgc        60
     aggactctgg aagaggaacg ggaattctgg cgttgttatg cccgggtcta tgaccagcac       120
     gccggggaga cgggtggctc gttggcgcag atcgcagccg taaccgagat cgtggagccg       180
     ggatcttcgg tcctcgacgt tggtggagga acgggaaggt ttgcgattcc gctggcacag       240
     cgcgggtgcc gggtgaccgt gctggatcga tccgaggaca tgctaagtgt cttggaaagt       300
     tctgccgagg agaaagacgt cgagatcgat gtcgttcatc aggaatggcc agcggacctc       360
     ggttgccagt ttgacagcgt tatagcagcg tggtcgttgt actggaatct cgacctacag       420
     gcatcgctcc aggccatggt gcggcagaca aagaagcatc tcatcatcat tgacaccact       480
     gggtcgccga ccgtgtggga tcacgcgctt gcggtggcta gagggggagg aatcgtagcg       540
     tctcaagcca ggcatctgtt gtttgccggg ggtttggcac aacttggcat acccgcggaa       600
     attcgggtgc tagaagagta tcgagttatc ggtgagaccg aactggagcg cgagatcgat       660
     gcccacggtg gcagcaaggt agctgcaatg gagtacctgg acactcacgc tgtgaggatt       720
     cgaagcggtt ggcgttacaa gcggaccgtt ggtctgatcc atgcgcaggg aaagaacatt       780
     ccagcacgga atttgtga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page