(data stored in ACNUC30630 zone)

EMBL: CP001977.PE78

CP001977.PE78        Location/Qualifiers
FT   CDS_pept        84594..85379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3078"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3078"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00766"
FT                   /db_xref="GOA:D4HEN6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEN6"
FT                   /protein_id="ADE00766.1"
FT                   /translation="MAGDGKMIKGAKLVVDNLGVDIDGHCIVDGVNFCAQPGDVVGILG
FT                   PSGSGKSTILRSIFHSRKPTRGSVTLDGVDVWSRDAKWSAQHICVVLQETPAEFPLTCG
FT                   EIVRMGRAPHKRSWQSLGAGDLELCHAAMEVMEVDNLAGSSFSRISGGERQRVTIARAL
FT                   AQQTGMIVMDEPTNHLDIHHKLKLMRLLRRLNATTVIALHDINLAGRFCDTLVLMSGGS
FT                   CVACGAPSTVLSPNVLDDVYHVKTDVVRQPNGTVHVTIL"
     atggcgggag acggaaagat gattaaaggt gcgaagcttg ttgtcgataa cttgggtgta        60
     gacatcgacg gacattgcat tgtcgatgga gtcaattttt gtgcccaacc aggagatgtt       120
     gtgggaatcc tcggtcctag tgggagtggt aaatcgacga tattgcggtc gatctttcac       180
     tcaaggaaac ctacgagggg gtctgtaact ttagatggag tagacgtctg gtcacgggac       240
     gcaaagtggt cggcgcaaca tatctgtgtg gtcctgcagg aaacacctgc ggagtttccg       300
     ctaacttgtg gtgaaattgt ccggatgggg agagcccctc acaaaaggtc gtggcagtcg       360
     ctgggagctg gtgatctcga actgtgccac gcggcgatgg aggttatgga agtcgacaac       420
     cttgcaggat cgtctttttc gaggatttct gggggtgaga gacagcgggt gacgatcgcg       480
     agggcgcttg ctcagcaaac cggcatgatc gtcatggatg agccgactaa tcatctcgac       540
     atccatcata aactcaagtt gatgcgccta ctccgtcgtc tcaatgcgac gacggtaatc       600
     gcactccacg acatcaactt ggcgggtcgc ttttgtgaca cgttggtttt gatgtcgggg       660
     ggaagctgcg ttgcctgcgg tgcgccgtcg actgtgctgt ctccgaacgt cctcgacgat       720
     gtttaccacg tgaagactga tgtcgttcgg cagcctaacg gaacggtcca cgtgaccatc       780
     ctgtga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page