(data stored in ACNUC30630 zone)

EMBL: CP001977.PE80

CP001977.PE80        Location/Qualifiers
FT   CDS_pept        86964..88250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3080"
FT                   /product="chloride transporter, ClC family"
FT                   /note="identified by match to protein family HMM PF00654"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3080"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99353"
FT                   /db_xref="GOA:D4HEN8"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEN8"
FT                   /protein_id="ADD99353.1"
FT                   /translation="MATSRIRFVAAVVLTGLASGLIGGLTSELSHLIEVCAFGVPFSSS
FT                   TTGVGEVVMWRRLVAPIMGALIAGLTWRWLRPFPSGSITSVRQAIDSPTRLRPVETIVD
FT                   ALAQLVVVGSGSSLGREAAPRQMAALAAQGLSDTFRVDVATRRVVLASAAGAGLASVYN
FT                   VPVAGALYALELTVRPDLRTKRGWGQVGIAGVISVLSTVTAWLLNHDRPIYRSPAATVT
FT                   GPGLGWMVLVVAVSTVVGAGMGVLFGEMKRRVPVTSRLWWTVLLGSAGVTVIALAAPQV
FT                   VGNGQVIVNLVLAHPVAPASLVILLVGKILATTVALRSGAAGGLLTPSLSAGALVGALV
FT                   AVVAGIDAPSQIAMMVIVGAGCVLSMTQRAPLFAAAFALELTRAGALGIPVVVAAVMLG
FT                   WTGFVLVSRRGLGLHGRIGRAPGHTSDPR"
     gtggccacct cacggatccg attcgttgcc gccgtcgtac tgacggggtt ggcgtcggga        60
     ctcatcggtg gccttacaag cgaactgtcc cacctcattg aggtctgcgc cttcggtgtg       120
     cccttctcct cgtcgacgac gggtgttggg gaagtcgtta tgtggcgacg cctcgtcgcg       180
     ccgattatgg gtgctctcat tgcgggcttg acgtggcggt ggctgcgtcc gttcccatcg       240
     gggtcgatta cctcggtgcg acaggccatc gactctccga cgcggctacg cccagtcgag       300
     accatcgttg acgccctcgc ccagctcgtc gtcgtcgggt caggaagctc cctaggccga       360
     gaggcggcac cgcgtcagat ggctgccctg gctgcccaag ggctatctga cactttccga       420
     gtcgacgtcg ccacccggcg ggttgtgctg gccagcgccg ccggtgccgg cctggcatcg       480
     gtctataacg tgcccgtcgc tggagcgctg tacgccctag aactgacggt gcgccctgat       540
     cttcgcacca aacgtggctg gggacaggtg ggaatagccg gcgtcatctc cgtcctatca       600
     acggtgacgg catggttgtt gaaccatgac cgccccatct atcgttcacc agccgccacg       660
     gtgacgggtc ccggccttgg ctggatggtt cttgtcgttg cggtttccac cgttgtagga       720
     gccgggatgg gagtgctctt cggggagatg aaacggcgag ttccggtcac ctccaggctg       780
     tggtggacgg ttctgttggg atcggccgga gtgaccgtca tcgctctggc ggcacctcaa       840
     gtggtcggaa atggccaggt catcgtcaat ctggtgctgg cccatcctgt ggctccagct       900
     agtttggtga tcctgctcgt cggcaagatt ctcgccacga cggtggcatt acgctccggt       960
     gctgccggcg gtctactcac cccgtcccta tccgcaggcg ccctggtcgg agctctggta      1020
     gccgtggtgg cagggatcga cgcaccctcc cagatcgcca tgatggtgat cgtcggtgct      1080
     ggatgcgtgt tgtctatgac ccagcgtgcc ccgctcttcg ccgccgcctt cgcgctagaa      1140
     ctgactcgtg ctggagcgct agggatcccg gtcgttgtcg cagcggtgat gctcggttgg      1200
     acagggttcg ttctcgttag taggcgtggt ctggggctcc acggacggat tggtcgggcc      1260
     ccgggccata cgtctgatcc gcggtag                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page