(data stored in ACNUC30630 zone)

EMBL: CP001977.PE88

CP001977.PE88        Location/Qualifiers
FT   CDS_pept        97301..98179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3088"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3088"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99109"
FT                   /db_xref="GOA:D4HEP6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEP6"
FT                   /protein_id="ADD99109.1"
FT                   /translation="MGGGGPFAALCILPALVLYVLFLVYPTLNVFRMSLFDWNGLGNAP
FT                   SFIGLDNFAALIHDPAFVRAFENTLFILVVVKIVTICSSIFIAAVLTRETLVGAGWYRF
FT                   VLYLPSVLSIVVVAAIFSAIFDQNNGLVNGLLQALGLGHGPVWLGDQNVVMYSVAIAMV
FT                   WQSLGYYVVLYMAGMSSVPVEIYESASLDGAGRMTQLGSITIPLIWSNIRTTLTFFVLS
FT                   SVNLAFVLVKALTDGGPNGSLEVLLNYMYKQAFTNSAYGYGMAIGVVTFLFSFLVAMLI
FT                   SHVTRREVLQY"
     atgggtggtg gtggcccctt tgctgcattg tgcattctgc cggcgctggt cctttatgta        60
     cttttcctcg tctatccgac gctcaacgta ttccgtatgt cgttgttcga ctggaatggg       120
     ctgggaaatg cccctagctt catcgggcta gacaacttcg ccgccctcat ccacgatccc       180
     gctttcgtcc gggcgtttga gaacacattg tttatcctcg tcgtagtgaa gattgtgacc       240
     atttgcagtt ccatctttat cgcggcggtc ctcactcggg agaccttggt gggagctggc       300
     tggtaccggt ttgtgcttta cctgccgtcg gtgctgtcca tcgtcgtcgt ggcagccatc       360
     ttctcggcaa ttttcgatca aaacaacgga ctggtgaacg gcctcctgca agcgctggga       420
     ctgggacacg ggccagtctg gctcggcgat cagaacgtgg ttatgtactc cgttgccatc       480
     gccatggtct ggcaatcgct cggctactac gtggtgctct acatggccgg catgtcgtcg       540
     gtgccagtcg agatctacga atcggcctcg ctggatggtg ccgggcggat gactcagttg       600
     ggatcgatca ccattcccct aatttggagc aacatccgta ccaccctcac cttcttcgtg       660
     ctgagttcgg tgaatctcgc cttcgtgctg gttaaggctc tgactgatgg tgggcccaac       720
     ggtagcttgg aggtgctgct caattacatg tataagcagg cgttcactaa ctcagcttat       780
     ggttacggta tggcgattgg cgtggtgacc ttcctgttct cgttcctcgt cgcgatgctg       840
     atcagccacg tgactcgcag agaagttctt cagtactaa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page