(data stored in ACNUC30630 zone)

EMBL: CP001977.PE91

CP001977.PE91        Location/Qualifiers
FT   CDS_pept        100309..102498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3092"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99728"
FT                   /db_xref="GOA:D4HEP9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016518"
FT                   /db_xref="InterPro:IPR027414"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEP9"
FT                   /protein_id="ADD99728.1"
FT                   /translation="MLAESWRLHYRSPAAEWEAYGLPIGNGRLGAVLRGDIARDVVQFN
FT                   ENSLWAESNNYDNGLCGVADDVFDTSMHGFGCYLDFGRVTISFADLDESTVSGYERALD
FT                   LRHAVAYACFDAGGVRHQRSAFASRETDVIVLRYSASAPFGCTVRLESAQGVPSRVAGD
FT                   TSVVFDGVLGNGLRYCASLVLLECDGRSIAHGDRIVVEDATTLALVLDAGTDYALSAVA
FT                   GWRGVNPRPVVDERICSATALGWERLHDAHVTKFSAVMDRCRLRWGRPVPELDAQPTDE
FT                   RLRRYRDGAADVGLEQLAVVLGRYLLVSSSRAEGLPANLQGLWNDSNDPAWGSDYHTNI
FT                   NVQMNYWGAEVTGLGEEHMALLNFVEEVAVPSRSATRAMCGPDVPGWTARTSQSPLGGN
FT                   GWQPNTVASAWYAHHVYEHWAFTRDDEWLRTRGLPMLAEICRFWEHQLVERDDGMIVAP
FT                   AGWSPEHGPREDGVAYDQQIVWDLFTNLLECSRALGVEDDLYYRVERLRDRLAPNQVGC
FT                   WGQLQEWQDDRDDPTELHRHTSHLFAVYPGRQITTDTPELQAAALVSLKARCGEPPPVA
FT                   GAPTVAPFRAEMVVGDSRRSWTWPWRAALFARLGDGYRAGEMVRGLLTYNMLPNLWTTH
FT                   PPFQVDGNLGLVGAVAEMLLPSHDGRIRLLPALPPAWEAEGEAIGLRARGGYRVSMQWR
FT                   DGQVIWFEIVADRGHAEDVIVVVNGREHRIRPDKR"
     atgctggctg agtcatggcg cctgcactac cgctcacctg cagcggagtg ggaggcttac        60
     ggactgccga tcggcaacgg ccgtctcggg gccgtcctac ggggggacat cgcacgtgac       120
     gtggtgcagt tcaacgagaa cagtttgtgg gcggagtcca acaactacga taacggcctg       180
     tgcggtgtcg ctgacgacgt tttcgacact tcgatgcacg gtttcgggtg ttacctcgac       240
     ttcggtcgag tgacgatcag cttcgccgat ctcgatgagt cgaccgttag tggctacgag       300
     cgcgcactgg acctgcgcca tgccgtggca tatgcctgtt tcgatgctgg tggcgtgcgg       360
     caccagcgtt cggccttcgc gagtcgtgag acagacgtca tcgttttgcg gtattcggca       420
     tcggcacctt tcgggtgcac ggtgagactc gaatcggcgc agggggtgcc ttcgcgcgta       480
     gctggcgaca catccgttgt cttcgatggc gtactgggca acgggctgcg ctactgcgcg       540
     agcttggtcc tcctggagtg cgatggccgg tcgatagccc atggcgatcg aatcgtcgtc       600
     gaggacgcga cgacattggc gctcgttctt gacgccggta ccgactacgc gttgagtgcc       660
     gtagccgggt ggcgtggcgt taacccacgg ccggtcgtcg acgaacgaat ctgctcggct       720
     acggccctgg gatgggagcg gctgcacgac gctcatgtca ctaagttctc agcggtgatg       780
     gaccggtgtc gcctgcgctg gggtcgtccc gtcccagaac tcgatgcgca gcccactgac       840
     gaacggctgc ggcgctatcg tgacggagcc gccgacgtgg gcttggagca gctcgctgtc       900
     gtgctgggtc gctacctgct cgtgtcctcg tcgcgggcgg aggggttgcc ggccaatctg       960
     caaggcctgt ggaatgacag caacgatcct gcttggggca gtgactacca cacgaacatc      1020
     aatgttcaga tgaactactg gggcgcggag gtaaccggcc tgggcgagga gcacatggcc      1080
     ttgctgaact tcgtggagga ggtagctgtc cctagccgtt ccgctacccg ggcgatgtgt      1140
     ggccccgatg tccccggctg gacggcgcgc acgtcccaga gcccgttggg gggcaatggg      1200
     tggcaaccca ataccgtggc gagcgcctgg tacgcccacc acgtctacga gcactgggcc      1260
     tttactcgcg atgacgagtg gctacgcact cggggtctgc cgatgctagc tgagatctgt      1320
     cgtttctggg agcaccagtt agtggaacgt gacgacggga tgatcgtcgc gccggcagga      1380
     tggtcgcccg agcacggccc acgcgaggac ggggtagcct acgaccaaca gatcgtatgg      1440
     gacctgttca ccaacctgct ggaatgctcg cgggccttgg gcgtcgagga cgacctctac      1500
     tatcgggtgg agcgcctgcg agaccggctg gcgcccaacc aggtgggctg ctggggccaa      1560
     ctgcaggagt ggcaggacga ccgggatgat cccaccgagc tgcatcgcca cacctcgcat      1620
     ctcttcgccg tctatcccgg gcgccagata accacagaca cacccgagct gcaggcggct      1680
     gcgctggtgt ccctgaaggc gcgctgtggg gaacctccgc cggtggcggg tgcacctacc      1740
     gtggcaccat ttcgcgctga gatggtagta ggcgacagcc gacgctcatg gacgtggccc      1800
     tggcgtgccg cgctctttgc tcgcctcggg gacggatacc gggccggtga gatggtgcgc      1860
     gggttgctga cctacaacat gttgccgaac ctgtggacca ctcatccgcc ctttcaagtg      1920
     gacggcaacc tagggctggt aggggccgtc gcggagatgc tgttgccgag ccacgacggt      1980
     cggattcgct tgcttcccgc tctgccaccg gcatgggagg cggagggcga ggcgatcggt      2040
     ctgcgggctc gcggcggcta tcgcgtctca atgcagtggc gcgacggcca ggttatctgg      2100
     ttcgagatcg tggcagaccg cggccatgcc gaagacgtca tcgtcgtggt caacgggcgc      2160
     gaacaccgga tccgccctga taaacgctga                                       2190
//

If you have problems or comments...

PBIL Back to PBIL home page