(data stored in ACNUC30630 zone)

EMBL: CP001977.PSTA

CP001977.PSTA        Location/Qualifiers
FT   CDS_pept        complement(411403..412329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="HMPREF0675_3381"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00974"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3381"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00312"
FT                   /db_xref="GOA:D4HAP0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAP0"
FT                   /protein_id="ADE00312.1"
FT                   /translation="MSATTPDHITHHGDNTPGQLDLSRPSGKRTIKSGCASAFMIVATV
FT                   LAVIPLAWLLFAAVRRGIGSLFHASWWTHSMDPSFDLAEQGAIHAIVGTLEIGLITSII
FT                   SVPIALMTAIFLVEYARGTKIAKGISFAVDVLTGVPSIVAALFVFAVVVTTFGGTQSAW
FT                   ASSLALMILMVPTVLRSTEEMLKLVPDSLREASFALGVSQWKTIMKVVLPTSMTGILTG
FT                   IVLGLARVMGETAPLIVLLQFNTELTFNPSTPNFATLPTVITNAYTQGGVDTPVVWGAA
FT                   ITLIILVMGLNLIARRISRRYMRRMGK"
     atgagcgcca ccacccctga ccacatcacc caccatggcg acaacacgcc cggacagcta        60
     gatctctccc gcccgtctgg taaacggact atcaagagcg gctgcgcctc agcattcatg       120
     atcgtggcca ccgtactggc tgttatccca ctggcctggc tgctcttcgc ggccgtccgg       180
     cgcggcatcg gatcactatt ccacgcgtcg tggtggaccc actcgatgga tccctccttc       240
     gacttggccg agcagggcgc catccacgct atcgtcggaa cccttgaaat tggccttatt       300
     acatcgatta tctcggtacc gatcgctctg atgaccgcga tcttcctagt cgagtacgcc       360
     cgcggaacta agatcgccaa gggcattagc ttcgccgtcg acgtgctaac cggtgtacct       420
     tcaatcgtcg cggccctctt cgtcttcgcc gtagtcgtta ccaccttcgg tggcacccaa       480
     tccgcgtggg cctcctcgtt ggccctcatg atcctcatgg ttccgacggt gctgcgatca       540
     accgaggaaa tgctcaagct cgtgccagac tctttgcgtg aggcctcctt cgccctgggc       600
     gtctctcaat ggaagacgat catgaaggtc gtcttgccaa cctccatgac tggcatcctc       660
     accggtatcg tgctgggctt agctcgagtt atgggcgaaa cggctccgct gatcgtgttg       720
     ctgcagttca acaccgagtt gacctttaat ccgtcaacac caaacttcgc gacgctgccg       780
     accgtcatca ctaacgctta cacccagggc ggcgtcgata ccccggtggt gtggggagcc       840
     gctattaccc tcatcatcct ggtcatggga ctcaacctca ttgcccgtcg gatctcccgc       900
     cgctacatgc gccgcatggg caagtga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page