(data stored in ACNUC30630 zone)

EMBL: CP001977.PSTS

CP001977.PSTS        Location/Qualifiers
FT   CDS_pept        complement(413439..414590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="HMPREF0675_3383"
FT                   /product="phosphate ABC transporter, phosphate-binding
FT                   protein PstS"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR00975"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3383"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99326"
FT                   /db_xref="GOA:D4HAP2"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAP2"
FT                   /protein_id="ADD99326.1"
FT                   /translation="MNRFAKITALAAISAISLTACGANGDKGSSSASSSKTTSTASSAA
FT                   QPSDSSADAVSFKPACPGGSISGAGSSAQLNAINQVISDYKAACSSATVNYSPTGSGAG
FT                   VKSFIGRQTDWAGSDSVLNADKGEPDKAKQRCNADPWHLPMAAGPIAVVYNVDGVKDLT
FT                   LSTATLAKIFSGAITNWNDDAIKKENPKAALPSAQIEVFYRKDESGTTDNFTKFLNKAA
FT                   GDIWTEKHSKTWKGAGKGADKSAGIAQAVKSTKNSISYDEWSYATKNSLDMAAIDNGNG
FT                   PVKLTGESAGKAVSAAKVVGQGHDLQLELQYKNTPAGVYPAVLVTYEIACSKGQDSGKA
FT                   ALLKDFLSFYASEREQKKIQDLGYAPLPSDVASKVLGSAQALS"
     gtgaatcgtt tcgccaaaat cactgccctg gctgctatca gcgccatctc cctcaccgct        60
     tgtggtgcca atggtgacaa gggttccagt tctgcctcgt cctccaagac cacctcgact       120
     gccagctccg ccgcccagcc cagcgattcc tcggctgacg ctgtctcgtt caagcccgcc       180
     tgccctggtg gcagcatctc cggtgctggt tcctcggctc agctgaacgc catcaaccaa       240
     gttatttccg actacaaggc tgcctgttcc tcagcaaccg tcaactactc ccccaccggc       300
     tccggcgctg gcgtgaagtc cttcatcggt aggcaaaccg actgggccgg ttctgactcc       360
     gtcctcaacg ctgacaaggg ggagcctgat aaggccaagc agcgctgcaa cgccgaccca       420
     tggcacctcc cgatggctgc tggcccgatt gccgtggtct acaacgtcga cggcgtcaaa       480
     gatctaaccc tctccaccgc gaccctcgcc aagattttct ccggcgccat cacaaactgg       540
     aacgacgacg ccatcaagaa ggagaacccg aaagccgcgt tgccttcggc ccagatcgag       600
     gtgttttacc gcaaggacga gtcgggcacc accgacaact tcaccaagtt cctcaacaag       660
     gcggccggtg acatctggac tgagaagcac tccaagacat ggaaaggtgc gggcaagggc       720
     gccgataagt cggccggcat cgcccaggct gtcaagagca ccaagaactc gatctcgtac       780
     gacgagtggt cctacgctac aaagaacagc ctcgacatgg ccgccatcga taacggaaac       840
     ggtccggtca agctgaccgg tgagtctgcc ggtaaggccg tctcggccgc taaggtcgtc       900
     ggacagggcc atgacctgca gctcgagctc cagtacaaga acaccccggc gggcgtgtat       960
     ccggccgttc tcgtaaccta cgagatcgct tgttccaagg gccaggactc cggcaaggcc      1020
     gcgctcttga aggacttcct gtccttctac gcttctgaga gggagcagaa gaagatccag      1080
     gaccttggtt acgctccgct accctccgac gttgcttcga aggttctggg ttccgcccag      1140
     gccctctcct ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page