(data stored in ACNUC30630 zone)

EMBL: CP001977.RADA

CP001977.RADA        Location/Qualifiers
FT   CDS_pept        complement(384878..386275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="HMPREF0675_3354"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by match to protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3354"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99549"
FT                   /db_xref="GOA:D4HAL4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAL4"
FT                   /protein_id="ADD99549.1"
FT                   /translation="MARKTQTPTWVCTECGWTTTKWVGRCGECQTWGSVVEKGAPKLTE
FT                   VTSSTPTSKAVPIGQVSEQAANRHLTGISELDRVLGGGLVPGVVVLLAGEPGVGKSTLL
FT                   LDVAAKWAKAGRRTLYVTGEESAAQVRLRAGRTKSLADELYLASETDLGTVLGHIEQTE
FT                   PSLMVLDSVQTVGTSQADGSPGGVSQVREVTGALVRVAKRRGMAVIIVGHVTKEGSIAG
FT                   PRTMEHLVDVVLNFEGDRHSGFRMVRATKNRYGPADEVGCFEMTDAGIMEVPDPSGLFT
FT                   SDNADPQPGTCVTVTIEGRRPLLSEVQALVAPSASEKYPRRITHGVKGGRVAMILAVLE
FT                   RKAGLPLSNRDVYVSTVGGARVSDPSADLAIAVSVASAVLDTNFPTRVVALGEVGLAGD
FT                   LRRVPGLERRVGEAARLGFDLAVVPRNSREAHTKIPTMHGLHVIEVGSVAEALSVLNLR
FT                   RQRKVNQ"
     atggcgagga agacgcaaac tccgacgtgg gtatgcaccg agtgcggctg gacgacgacc        60
     aaatgggttg gccgatgcgg cgagtgtcaa acctggggtt cggtagttga aaagggggca       120
     ccgaagctca ctgaggtcac ctcatcgacg cccacgtcga aggctgtgcc catcggtcaa       180
     gtcagtgaac aagccgctaa tcgtcatctc accgggatca gcgaactcga ccgggtactg       240
     ggtggtggtc tagtgcctgg agtcgtggtt ttgctcgccg gagagccagg agtcggaaaa       300
     tcgaccctgt tgctcgacgt tgcggccaaa tgggctaaag cgggcaggcg caccctttac       360
     gtcactgggg aggagtcggc tgcccaggta aggctgcggg ctggtcgcac gaagtcgcta       420
     gccgacgaac tctacctagc ttctgagacc gatctgggta cggtgcttgg acatatcgag       480
     caaaccgagc cctccctcat ggtgttggac tccgtacaaa cggttggcac cagccaggct       540
     gacggctccc ccggcggcgt ttcacaggtt agggaggtca ccggggccct ggtgcgggtg       600
     gcgaagagac gcgggatggc agtcatcatc gtcggccatg tcaccaaaga agggtcgatc       660
     gctggcccgc gcaccatgga acatctcgtt gacgtcgtcc tcaacttcga gggtgaccgc       720
     cattccggat tccgtatggt ccgcgccacg aaaaaccgct acggcccagc cgacgaggtg       780
     ggctgcttcg agatgaccga cgccggaatc atggaggttc cggacccgtc tggcctattc       840
     acctcagaca acgccgatcc tcagccgggc acctgtgtga cggtgacgat agagggacgc       900
     cgtcccctac tctcagaggt gcaggcgttg gtagctccgt cagcttccga gaaatacccg       960
     cgtcgcatca cccatggggt caagggcggt cgggtggcca tgattctggc cgtgctggaa      1020
     cgtaaagcag gtttgccgtt gagcaaccga gacgtctacg tctcgacggt gggtggcgcc      1080
     cgggtgtccg acccgtcagc tgacctagcg atcgcggtct cggtcgcctc cgcagttctt      1140
     gataccaatt tcccgacccg agtcgttgct ctgggagaag tcggtctggc gggagatttg      1200
     cgccgcgttc caggactaga gagacgagtg ggtgaggcgg cacggttggg gttcgacctg      1260
     gcagtggtgc cacgcaactc tcgggaggca cataccaaga tcccgacgat gcacgggttg      1320
     cacgtcatcg aagtcgggag tgtggccgaa gctctttcgg tgcttaacct gcgccgacag      1380
     cggaaagtaa accagtga                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page