(data stored in ACNUC30630 zone)

EMBL: CP001977.THID

CP001977.THID        Location/Qualifiers
FT   CDS_pept        132840..134549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="HMPREF0675_3113"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="identified by match to protein family HMM PF01256;
FT                   match to protein family HMM PF03070; match to protein
FT                   family HMM PF08543; match to protein family HMM TIGR00097"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3113"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00486"
FT                   /db_xref="GOA:D4HF52"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF52"
FT                   /protein_id="ADE00486.1"
FT                   /translation="MFGRFSAAERKLWWGDILVFGHGVRLGGAEITPVEPDLVRTGEGM
FT                   SEMTTSDALAERGTIPRVLSIAGTDPSGGAGTAADTKSIVAAGGYAMVVVTSLVAQNTE
FT                   GVRAIHTPPTDFLVQQLAAVSDDVRIDAVKTGMLGTAEIVDAVATFLDEHRPPVVVVDP
FT                   VMVATSGDRLLAPDAEAAMREFCRRATVITPNIPELGVLCQSEPATTPEQAVEQARRWA
FT                   AETGVAVVVKTGHLNSQRVDNMWVTPEGAMHTVPAARVKTTNTHGTGCSLSSALATRLG
FT                   AGDTPGDALAWVTDWLHEAIQYGSALNVGKGHGPVDHSHRARRLAKDASAVAWFAPIDP
FT                   LESPQGLVGSAEPSPDAVVGPAGPWTTALWQASGDIARRIEDSDFVAALVDGTLSKPAF
FT                   EFYLGQDAQYLTYYSRALASLAARAVDPEESVWWAQSSQACLVEEAELHRSWLGDHIDV
FT                   VAGPVTLAYTDFLLARALGDDYVVGTAAVLPCFWLYAHLGAKVPHVPDDHPYASWLQIY
FT                   GDPEFVEGASHTIGLVEKAFQNASAVTRARAAHAYLTACRHELEFFDQALRV"
     gtgttcggtc ggttttcagc ggcggagcgc aagttgtggt ggggtgacat actggtcttt        60
     ggacacgggg tgcgcctcgg tggcgctgag atcacacccg tggaacctga tctagttcgt       120
     actggcgaag ggatgtccga gatgaccact agtgatgcgc ttgccgagcg gggaacaatt       180
     ccccgcgtcc tgtcaattgc gggtaccgat ccgtccggtg gagctggcac cgcagccgac       240
     accaaatcaa tcgtcgcggc aggtggatat gcgatggttg tcgtcacctc cttggtggcc       300
     cagaacaccg aaggggtgcg cgccatccac accccgccga ccgacttcct ggtccagcaa       360
     ctggccgctg tcagtgatga cgtgagaatc gacgccgtca aaaccggaat gctcggcacc       420
     gctgagatcg tcgacgcggt tgcgaccttc ctcgacgagc atcgaccgcc ggtagtcgtc       480
     gtcgatccgg taatggtcgc cactagcggg gaccgccttc ttgcccccga cgcagaggct       540
     gccatgcgcg agttttgtcg ccgcgcaacc gtcatcaccc cgaatattcc ggagctcggg       600
     gtgctgtgcc agagcgagcc ggcgacgacc ccggaacagg ccgtggagca ggctcgtcgg       660
     tgggcggctg agacgggagt ggctgtcgtc gtcaagaccg ggcatttgaa ttcgcagcgg       720
     gtcgacaata tgtgggtgac gccggaagga gcaatgcaca ccgtcccggc ggcgcgggta       780
     aagacgacca acacccacgg taccgggtgc tcactgtcct cagccttggc gacccggttg       840
     ggtgccggtg acaccccggg ggatgccctg gcgtgggtca ccgactggct gcacgaagcg       900
     attcagtacg ggtcggcgct gaacgtcggt aagggccacg gcccggtgga ccactcccat       960
     cgggcacgtc ggctggccaa ggacgcctcg gcagtggcgt ggtttgcgcc catcgacccc      1020
     ttggaatccc cgcaagggtt ggttggatcg gcagagcctt caccggacgc ggtggttggc      1080
     ccagccggcc catggacgac ggccctgtgg caagcaagtg gggacatcgc tcgtcgcatt      1140
     gaggactcgg attttgttgc cgctctcgtc gacggcaccc tgtcgaagcc ggccttcgag      1200
     ttctacctgg ggcaggacgc tcagtacctc acctactatt cacgagcttt ggcatccttg      1260
     gcggctcgtg ctgtcgaccc ggaggagtca gtgtggtggg cgcagtcctc tcaggcgtgc      1320
     cttgttgagg aggcagaact gcaccgctct tggttagggg atcacatcga cgtggttgcc      1380
     gggccggtga ccttggccta cacggacttt ctgctggccc gggcattggg tgacgactac      1440
     gtcgtcggta cggcagcggt actgccttgt ttctggcttt atgcacactt gggtgccaag      1500
     gttccgcacg ttcccgacga ccacccttac gcttcatggt tgcagatcta tggggatccc      1560
     gagttcgtcg agggggcgtc acacaccatc ggtctggtgg agaaagcctt ccagaacgcc      1620
     tccgccgtca ccagggctcg cgctgcccat gcctacctga cggcctgccg tcacgaattg      1680
     gagttcttcg accaagcttt gcgggtctga                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page