(data stored in ACNUC30630 zone)

EMBL: CP001977.TMK

CP001977.TMK         Location/Qualifiers
FT   CDS_pept        322841..323485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="HMPREF0675_3289"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="identified by match to protein family HMM PF02223;
FT                   match to protein family HMM TIGR00041"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3289"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99737"
FT                   /db_xref="GOA:D4H9N5"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9N5"
FT                   /protein_id="ADD99737.1"
FT                   /translation="MTDQTVTGRDLGGVFVVFEGGDGAGKTTQARLLDQWLTTEGIPHL
FT                   MTREPGDSWLGQRIRELVLSPGSGPISSRAEALLYNADKAQHVDEVVIPALREGKVVVC
FT                   DRYVDSTIAYQGAGRALDPGEVGQLACWATTGLVPDVTVLLDVDPCEGAGKIAAKDRLE
FT                   AAGDEFHLRVRQHFLDLAAAHPQRYLVLNARKSRKEISEAIRQRVTGLLNR"
     atgactgatc agacggtgac tggccgcgat ctgggcggtg tattcgttgt cttcgagggt        60
     ggggacggtg ccggtaagac gacccaggcc cgactacttg accagtggct gacgaccgag       120
     ggaatccctc acctcatgac tcgcgagccc ggggattcct ggcttgggca gcggatccgc       180
     gagctggtgc tctctcctgg ctccgggccg atctcctcgc gcgctgaggc tttgctgtac       240
     aacgccgaca aggctcaaca cgtcgacgag gttgtcattc cggctttgcg agagggcaag       300
     gtcgtcgttt gcgaccgtta cgttgactcg actatcgcct atcagggggc tggcagggcc       360
     ctcgaccctg gcgaggtcgg ccagctcgcg tgctgggcga cgaccggcct ggtacctgat       420
     gtgacggttc tgctcgacgt cgatccctgc gaaggggccg gtaagatcgc cgccaaggat       480
     cgtctggaag ctgctggtga cgagttccac cttcgggtgc gtcaacattt tcttgacctc       540
     gctgcggccc atccgcagcg atacctcgtg ctgaacgcgc ggaagagtcg caaggagatc       600
     agtgaggcca tccgtcagcg cgtgactgga ttgctcaacc ggtga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page