(data stored in ACNUC30630 zone)

EMBL: CP001977.TRXA

CP001977.TRXA        Location/Qualifiers
FT   CDS_pept        555472..555837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="HMPREF0675_3530"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3530"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00043"
FT                   /db_xref="GOA:D4HBZ8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBZ8"
FT                   /protein_id="ADE00043.1"
FT                   /translation="MATVALTKDNFSSTIDSNDVVLIDFWASWCGPCQRFSPIYEDASG
FT                   RHSDVTFAKVDTEDQQELSAGLEITSIPTIMAFRAGYLVFRQSGLLQGRQLDELIEKVK
FT                   EIDVEDLKKQAAAQNQG"
     gtggctaccg tcgcattgac taaagacaac ttctcctcga ccatcgattc caatgatgtc        60
     gttctcattg acttctgggc ctcctggtgt ggaccatgcc agcggttttc accaatctat       120
     gaggacgcca gtggacgtca ctctgacgtg accttcgcca aggtcgacac cgaggaccag       180
     caggaactgt ctgccggtct ggagatcacc tccatcccga cgatcatggc cttccgtgcc       240
     ggataccttg ttttccgcca gtcaggcctg ctgcaaggtc gccagcttga tgagcttatt       300
     gagaaggtca aggagatcga cgtcgaggat ctcaagaagc aggccgcggc ccaaaaccag       360
     ggctga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page