(data stored in ACNUC30630 zone)

EMBL: CP001977.XSEA

CP001977.XSEA        Location/Qualifiers
FT   CDS_pept        complement(646667..647914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="HMPREF0675_3629"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF01336;
FT                   match to protein family HMM PF02601; match to protein
FT                   family HMM TIGR00237"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3629"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99263"
FT                   /db_xref="GOA:D4HC87"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC87"
FT                   /protein_id="ADD99263.1"
FT                   /translation="MVEPNAADNPRSLAWVVNAVKGWVERCGAIWVQAQVIEITRRSSP
FT                   TQFLTLRDPIEEISASATCHRRVLDAAGPIETGMTVTALIRPTVWSRTGRLSFEISEIT
FT                   PTGEGQLLAQLERRKRLLEAEGLFDVTLHRPIPVSPRGIGLITGAGSDAERDVQRHATL
FT                   RWPAARFVVHNTRVQGPMAAQQIIAALADLDADPTVDVIVIARGGGPLEDLLPFSDEAL
FT                   VRAVYATRTPVVSAIGHDRDNPILDLVADLRASTPTDAGKLIVPDAAEQSQAIETARAQ
FT                   LRQAVTRFIDVESGHLSQIRSRPVMVNPAATLDIAVERLDSTLQRLRLATHRVLDAESR
FT                   DVNHMLERVRAMSPKATLDRGYAILADTEGDSITSVNDTNARANLLVYLSDGTLSVTVD
FT                   SLDRRTPNRPTFQEDS"
     atggtcgagc cgaacgccgc cgacaatccg cgctccctgg cgtgggtcgt caacgccgtc        60
     aaggggtggg tagagcgctg cggagccatc tgggtgcaag cccaggtaat cgagatcacc       120
     aggcgctcca gtccgacaca gttcctcacc ctgcgcgacc ccatcgagga gatttcggcc       180
     agcgccacct gccatcgcag ggtcctcgac gccgccggac caatcgagac gggcatgacg       240
     gttaccgccc tcatccgacc gacagtgtgg tcgcgcactg ggaggctctc cttcgaaatc       300
     tccgagatca cccccaccgg tgagggccag ctcctcgccc aactagagag acgcaaacga       360
     cttctcgagg ctgaagggct cttcgatgtc accctccata ggccgattcc cgtttcgccc       420
     cgcggcatcg gtctcatcac cggagctggc tccgatgctg aacgtgacgt ccagcgtcat       480
     gccacgttgc gctggcctgc cgcccgattc gtcgtccaca acacccgggt acagggcccc       540
     atggcggccc aacagatcat cgccgccctc gctgaccttg acgccgaccc caccgtcgat       600
     gtcatcgtca ttgcccgcgg tggtggcccc ttggaagacc tcctcccctt cagcgacgaa       660
     gctctggtga gagcggttta cgccacccgg actcccgtcg tttcggccat cggtcatgac       720
     cgtgacaatc cgattctcga tctcgtcgct gacctacgcg cgtcgacgcc cactgacgcg       780
     ggcaagctca tcgtcccgga tgctgctgag cagtcccaag ctatcgagac agccagagct       840
     caacttcgcc aggccgttac gaggttcatc gacgtcgaaa gcggacacct ctctcagatc       900
     cgctcccgcc cagtaatggt caatccagca gccactctcg atatcgcggt agaaaggctc       960
     gactccacac tgcaacgtct acgtcttgct actcaccgcg tcctggacgc cgagagccgc      1020
     gacgtcaacc acatgcttga gcgcgtgcga gcaatgtcgc ccaaggccac cttggatcgc      1080
     ggctacgcca tcctcgccga cacggagggc gactccatca cctcagtcaa tgacaccaac      1140
     gcacgcgcga acctattggt ctacctgtct gacggtaccc tcagcgtcac cgtcgattct      1200
     ctcgaccgcc gcaccccaaa ccgtcccacc ttccaggagg actcatga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page