(data stored in ACNUC30630 zone)

EMBL: CP001977.YCHF

CP001977.YCHF        Location/Qualifiers
FT   CDS_pept        654632..655705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychF"
FT                   /locus_tag="HMPREF0675_3635"
FT                   /product="GTP-binding protein YchF"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF06071; match to protein
FT                   family HMM TIGR00092"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3635"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99636"
FT                   /db_xref="GOA:D4HC93"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC93"
FT                   /protein_id="ADD99636.1"
FT                   /translation="MALTIGIVGLPNAGKSTLFNALTKNDVLAANYPFATIEPNVGVVG
FT                   VPDKRLDVLTEMFHSAKTIPATVSFVDIAGIVKGASKGEGMGNEFLSNIREADAICQVT
FT                   RCFADDDVTHVNGHVDPSDDIETITTELVLADLQTMEKQLPKLQKEAAIKKESRPKVEA
FT                   WEQAKAVLEEGKTIFSAGLDPEPLHDLFLLTTKPFIYVFNCDQDQLADADFQAKMEKLV
FT                   APAEAIFLDAEFEAELAEMEPEDAAEFLADAGIEEPGLDKLARVGFDTLGLQTFLTAGE
FT                   KESRAWTIHKGDTAPEAAGVIHTDFQKGFIKAQVVSFGDLVEFGGEKEAQAAGKLRLEG
FT                   KEYVMQDGDVVEFRFNV"
     gtggcactta cgattggaat cgtcggtctt cccaacgccg gcaagtcgac tctgttcaac        60
     gcgctgacca agaatgacgt cttggcggcg aactacccct tcgcgaccat tgagccgaat       120
     gttggcgtgg tcggggtgcc ggacaagcgc ctcgatgtgc tgacggagat gtttcattcc       180
     gctaagacca ttcctgcgac ggtgtccttc gtcgacatcg ccggaatcgt caaaggcgct       240
     agcaaaggtg aggggatggg caacgagttc ctctctaaca ttcgtgaagc cgacgccatc       300
     tgccaggtga caaggtgttt cgcagacgac gatgtcaccc acgtcaacgg tcacgtcgat       360
     ccctccgacg acatcgagac cattactaca gagctcgtgc tcgctgatct gcagacgatg       420
     gagaagcaac tgcccaagtt gcaaaaagaa gccgcgatca agaaggagtc tcgtcccaaa       480
     gtcgaggcgt gggagcaggc taaggcggtg ctcgaagagg gcaagacgat cttctcagcc       540
     gggctcgatc ccgagccgtt gcatgacctc ttcctgctga cgacaaagcc cttcatctac       600
     gtctttaact gtgaccagga tcagctcgct gacgccgatt tccaggccaa gatggagaag       660
     ttggtggctc ctgctgaggc gatcttcttg gatgctgagt ttgaggctga actggccgag       720
     atggagcccg aggacgctgc tgagttcctt gcggatgcgg gtatcgagga acccggtcta       780
     gacaagctcg cgcgggtggg cttcgacact cttggtctac agaccttcct aactgcgggg       840
     gagaaggagt cccgcgcatg gacgattcac aagggcgaca ccgcccctga ggctgctggc       900
     gtcatccata ccgacttcca gaaggggttc atcaaggccc aggtggtgtc cttcggcgac       960
     cttgttgaat ttggcggcga aaaggaggcc caggctgctg ggaagttgcg gttggagggc      1020
     aaggagtacg ttatgcagga cggtgacgta gtggaattcc gatttaacgt gtag            1074
//

If you have problems or comments...

PBIL Back to PBIL home page