(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE1

CP001994.PE1         Location/Qualifiers
FT   CDS_pept        167..1402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0001"
FT                   /product="ORC complex protein Cdc6/Orc1"
FT                   /note="COGs: COG1474 Cdc6-related protein AAA superfamily
FT                   ATPase; InterPro IPR003959:IPR015163:IPR003593:IPR014277;
FT                   KEGG: cdc6; cdc6 protein; K02213 cell division control
FT                   protein 6; PFAM: CDC6 domain protein; AAA ATPase central
FT                   domain protein; SMART: AAA ATPase; SPTR: Q12VA1 ORC complex
FT                   protein Cdc6/Orc1; TIGRFAM: orc1/cdc6 family replication
FT                   initiation protein; PFAM: ATPase family associated with
FT                   various cellular activities (AAA); CDC6, C terminal;
FT                   TIGRFAM: orc1/cdc6 family replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35539"
FT                   /db_xref="GOA:D5E8N0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8N0"
FT                   /protein_id="ADE35539.1"
FT                   /translation="MDNSSLDGLFEELLETESLFKNKEVLRPAYTPENLPHRSDQINNI
FT                   ATVLVSALRGHTPSNVLIYGKTGTGKTAVARYVGIELERKSDHLNVQCNVLYINCEVID
FT                   TQYRLLANLAKQFGEDVPMTGWPTDQVFFRFKEAVDSRKQVIIIILDEIDKLIKKGDDV
FT                   LYNLSRMNTDLQNARVSMIGISNDLKFTEFLDPRVKSSLGEEEIIFPPYDAEQISDILR
FT                   QRAAIAYKENSMDDMVIPLCSAFAAQEHGDARRALDLMRVAGEIAEREKKNIIEEEHVR
FT                   QAQEKIEVDRIVEVIRTLPTQSKLALYSVMLLRNNGHRNVTTGEVYNVYRQLCRNVDTD
FT                   ILTQRRVTDLISELDMLGILNAIVVSKGRYGRTKEIVLSVPVESTKKVLLEDYRLNMLA
FT                   DFKPVLTAQMHL"
     atggataata gttcacttga tgggttattt gaagagttat tggagacaga atcccttttt        60
     aagaataagg aagtgttgag acctgcgtat acaccggaaa atcttcctca ccgaagtgat       120
     cagataaata atattgctac ggtactggta tcagctttga ggggtcatac accttctaat       180
     gttctcattt atggaaaaac aggtacaggt aaaactgcag ttgccagata tgtgggtatt       240
     gaacttgaaa ggaaaagtga tcatctcaat gtacaatgta atgtccttta cataaactgt       300
     gaagtaatag atacacagta caggttactg gccaatcttg caaaacagtt cggtgaagat       360
     gttcctatga cagggtggcc tacagatcag gtttttttcc gatttaaaga ggcagtggat       420
     tccaggaaac aggttattat tataattctt gatgaaattg ataaactgat taagaaaggg       480
     gatgatgtcc tctacaatct ttcccggatg aatacggatc ttcaaaatgc ccgtgtaagc       540
     atgataggta tttccaatga cctgaagttc actgaatttc tggatccacg tgtgaaaagt       600
     tctctgggtg aggaggaaat tatctttcca ccctatgatg ccgaacagat aagcgatatt       660
     ctcaggcagc gtgcggctat tgcctataag gaaaacagca tggatgatat ggtaattcct       720
     ctatgttctg cttttgcggc acaggaacac ggcgatgcac ggcgtgctct tgatctgatg       780
     agggttgccg gggaaatagc cgaacgggaa aagaagaata ttatcgagga agaacacgtc       840
     aggcaggccc aggaaaaaat cgaagtggat cgtatagtgg aggttatccg tactcttcct       900
     acccagtcca agctcgctct ctatagtgta atgctgctac gtaataatgg ccaccgtaat       960
     gtgacaacgg gtgaagtgta taacgtttat aggcagttat gccgcaatgt tgataccgat      1020
     atcctgaccc agagaagggt aaccgatctc atatcagaac ttgatatgct gggtatcctc      1080
     aatgctatag ttgtgagtaa gggtaggtat gggcgtacca aggaaatagt cctgagtgta      1140
     cctgttgaaa gcaccaagaa agtattgctt gaggattatc gtctcaatat gctggctgat      1200
     ttcaaaccgg tactaacagc ccagatgcat ctttaa                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page