(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE100

CP001994.PE100       Location/Qualifiers
FT   CDS_pept        107795..108541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0102"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UI6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35638"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8X9"
FT                   /protein_id="ADE35638.1"
FT                   /translation="MSSYEKMSEIINFSLDELYAITRYLHEKEDVDNPTTVLIGGWAVD
FT                   SYNSWYGSVDIDLITNNSTRNSLNYYLRKERNFVPYRLPGQPRSVRKETRAGSVIIDFA
FT                   TREKPFPFEGTDEYLDFSILDGNTESRAIRGNIEMAVPNRATLIVLKLKAIWDRNNRIS
FT                   HGNSHDIEWESGKLVKDYADILALIDPNSGGKDVEISILGKLMNTYPFLKESLASVGES
FT                   DDGIEKYGRMSESTAKRIIGQMLSLI"
     atgagttctt atgaaaagat gagtgaaata attaattttt cactggatga attatatgca        60
     ataacaagat atctccatga aaaagaagat gtagataacc ccacaactgt actgattgga       120
     gggtgggcag tagactcgta taattcctgg tatggctcag tagatatcga tcttattacc       180
     aataatagta cacgaaacag tctaaattat tatctgcgaa aggagcgtaa ttttgtacca       240
     tacagactgc ccggacaacc ccggagtgta aggaaagaaa caagagcagg gtctgtaatt       300
     attgattttg caacaagaga aaaaccattt ccttttgaag ggacagatga gtatttagat       360
     ttcagtattc ttgacggaaa cactgaatcc agggcaatcc ggggtaacat cgaaatggca       420
     gtacccaaca gagcaacgtt gattgttctg aaattaaaag cgatatggga tcgaaataat       480
     agaatatccc acggaaacag tcatgatatt gaatgggaat ccgggaaact tgtcaaagac       540
     tatgcagata ttcttgcatt aattgacccc aacagtggcg ggaaagatgt tgaaatttct       600
     atcctgggta aattaatgaa cacatatcca tttctaaaag aatctcttgc atcagtaggt       660
     gaatcagatg atggaataga aaaatatggc agaatgtcag aaagcactgc taaaaggatt       720
     attggacaga tgttgtcttt gatctga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page