(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE102

CP001994.PE102       Location/Qualifiers
FT   CDS_pept        complement(108647..109591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0104"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_2209 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin; SPTR: Q12TZ1 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35640"
FT                   /db_xref="GOA:D5E8Y1"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Y1"
FT                   /protein_id="ADE35640.1"
FT                   /translation="MQMIFNREGVLRAARLLLLTSFILIFLTPSFSLASDDTYFSGDNI
FT                   TVDLEIDANQETPAQLQLMIYNPHNKLVGNATHEFGLEKGENLVNYTMPFVTDTEGLHY
FT                   LRYDIFADLDGGWTLVQSSTQYFDGQINDPPLIEIISPTEDGVYALDEDILFSANVSDP
FT                   ESHSFSVAWRSNVSGIIGNGTSLYASLAEGMHLINVTAEDERGAASNRSILIQVVESAD
FT                   DQEDGVTAGTGGGGTGSATIVTDTSLEDDTAAAGDGDATVSPGDREQTDVPDGDTDETP
FT                   VGPEQEEESSFLPGFGAVFVVIGLLLAARFKRK"
     atgcagatga tttttaacag agaaggggtt ttgagagcgg cgaggctgct tctattaacc        60
     tcttttattt tgatttttct gacgccttcg ttttcgctgg cctcagatga tacctatttc       120
     tcgggagaca atatcacggt tgatctggag attgatgcaa atcaggaaac accggcacag       180
     ctacagctga tgatatacaa tccgcacaat aaacttgtgg gaaatgcaac ccatgagttt       240
     gggcttgaaa agggagagaa tctggtgaat tataccatgc cgtttgttac tgatacggaa       300
     ggtttgcatt atctcaggta tgatattttt gcagatctgg atggaggctg gaccctggtt       360
     caaagcagta cccagtattt tgacggacag atcaatgatc cgcccctgat tgagattatt       420
     tctccgacgg aagatggtgt gtatgctctg gatgaggata ttctgttctc ggcaaacgtg       480
     tctgatccgg aaagtcattc tttcagtgtt gcatggagat ccaatgtcag cggaattatt       540
     ggcaatggca catcccttta tgccagtctt gctgaaggta tgcatctgat caatgtgaca       600
     gccgaggatg agaggggtgc tgcaagtaat cggagtattc tcatacaggt tgtagaatct       660
     gcagatgacc aagaggatgg tgtgaccgca ggcacgggag gcggaggtac aggttctgct       720
     acaatagtta ccgatacttc cctggaagat gatactgcgg ctgcaggcga tggggatgcc       780
     actgtgtccc caggtgaccg ggagcaaacc gatgtccctg atggcgatac ggatgaaacc       840
     ccggttggcc ctgagcagga ggaagagtca agtttcctgc ccggttttgg agccgttttt       900
     gtggtaattg ggcttttgct ggctgccagg tttaagagga agtaa                       945
//

If you have problems or comments...

PBIL Back to PBIL home page