(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE104

CP001994.PE104       Location/Qualifiers
FT   CDS_pept        121184..122335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0106"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="COGs: COG0675 Transposase and inactivated
FT                   derivatives; InterPro IPR010095; KEGG: noc:Noc_2902
FT                   transposase; PFAM: transposase IS605 OrfB; SPTR: Q12TW2
FT                   Transposase; TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   Putative transposase DNA-binding domain; Probable
FT                   transposase; TIGRFAM: transposase, IS605 OrfB family,
FT                   central region; transposase, putative, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35642"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Y3"
FT                   /protein_id="ADE35642.1"
FT                   /translation="MFLTKTVILKIANPDNDLVETMKKYSDGMNYASEVLFDKGKPIPA
FT                   MKLQQEVYPYLRETLKLKSQMSCNIPRQVAGCYKTLKKQKKAKWQKVEFSPSSMTFSYK
FT                   RDFVIDEDTVKITTINGRKAYSILNYDYAKQYFEGSWKYQASKVVKHKDGDYYFHLSLE
FT                   KEAPDKEITDASTFMGIDVGMNYLAVASTTDRKCSFFAGGEIKNLRNQYKSMRKRLQSK
FT                   GTLSAKRMLKYISGKEKRLMRDVNHTISKEIVKFAVKNKVSVIGLEDLTGIRDSTLSKV
FT                   SKKRRHNHSSWAFRQLQTFIEYKAKEVGIITHYVDPSYTSQTCIRCNHISKNNRNRLSF
FT                   RCEKCDYANNADLIGAMNIEHKTRDYRYILESQGCLSATQTNA"
     atgtttctca ctaaaacagt tatcttgaaa atagcaaatc ctgataatga tttagtggaa        60
     actatgaaga aatattctga tggaatgaac tatgcttctg aagttctttt tgataaaggt       120
     aaaccaattc cagcgatgaa attacagcag gaagtttacc catatcttcg tgaaacatta       180
     aaattgaaat cccagatgag ttgtaacatt ccaagacagg tggcagggtg ttacaaaaca       240
     ttaaaaaaac agaaaaaggc aaaatggcaa aaagtagaat tttcgccatc atccatgact       300
     ttttcttaca aaagggattt tgtgattgat gaagacacgg tcaaaataac tactatcaac       360
     ggaagaaaag catattccat tttgaattat gactacgcta aacagtattt tgagggctca       420
     tggaaatacc aggcatccaa agttgtaaaa cataaagacg gagattatta tttccattta       480
     tctcttgaaa aggaagctcc tgacaaagaa ataacagacg cttctacttt catgggtata       540
     gatgtaggta tgaactatct tgctgttgct tccactaccg acaggaaatg tagttttttt       600
     gctggtggtg aaattaagaa tcttcgcaac caatacaaat caatgcgaaa gcgtttacaa       660
     tcgaagggaa ctttatctgc aaaacgaatg ttgaaataca tttcaggtaa agagaaacgt       720
     cttatgcgag atgtaaacca tacaatctca aaagaaattg tgaaattcgc agttaaaaac       780
     aaagtatcag taataggtct ggaagattta acaggaatac gtgattccac tctttccaaa       840
     gtttccaaaa agagaagaca taaccacagt agttgggctt tccggcaatt acaaacattc       900
     attgaataca aagcaaaaga agtaggcata atcactcatt atgttgaccc atcctatact       960
     tctcaaactt gtattcgatg caatcatatc tctaagaata accgtaacag attgtctttt      1020
     agatgtgaaa aatgtgatta tgcgaataat gcagacctaa tcggtgcaat gaatattgaa      1080
     cacaaaacac gggattacag gtatatcctg gaatctcagg ggtgcttgtc agccacccag      1140
     acgaatgctt aa                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page