(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE105

CP001994.PE105       Location/Qualifiers
FT   CDS_pept        complement(122773..127926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0107"
FT                   /product="PKD domain containing protein"
FT                   /note="InterPro IPR000601; KEGG: gem:GM21_2451 fibronectin
FT                   type III domain protein; PFAM: PKD domain containing
FT                   protein; SMART: PKD domain containing protein; SPTR: Q12XJ3
FT                   KP-43 peptidase. Serine peptidase. MEROPS family S08A;
FT                   TIGRFAM: LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35643"
FT                   /db_xref="GOA:D5E8Y4"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Y4"
FT                   /protein_id="ADE35643.1"
FT                   /translation="MEYKLNQIRKIILLSFLITISLIIGILSFSVMAMADSGEDSSIGG
FT                   VRAAEKDGCMFLGSDFIEVGILPNGGFGADTNAPESFFGSERSGGIGLYADLDGFYNDT
FT                   YDYRYDYFLPGSPEERWSVGFMKDGTKYSDSNGRNAGYNIPTTITNITNSKTGHITVDS
FT                   IYEDKLVINQTYELKPTERFLKVNVTLTNAGPDMMENVRYQRSFDPDNGVDVGCNYATK
FT                   NTIVSQQGTSNKAIVKAELKDGDLSTDIGQISSIPIFYYTQDEDARVSYGSSGLIPNNP
FT                   PYGDLDWDSAPSEGDSVEADSYIALTFNKSSLAPGQSVDYTFYIGLTKNIDETISDVEE
FT                   DAGNTDSSPSIFNSTPEAFFINNDGTNRDVNTNFTFAYSGENVSLMTQLNNSSVTAVTA
FT                   NFSTIPGEPAGQIPFEYHGEGIFTLLNHTLPDSEPGIYYITILANSSGQMNSTICPVML
FT                   NFNPKTDISGLANPNTTDWTTIDDLTNVSNLTFEANDGNGNVIGSMEFTETVNLCDIEF
FT                   AQKLQQFGEYVNFATAQTTLDSENLSRLNVSSNLTMRGLESFDSQPGILLNDQPILQTG
FT                   QTSNGSVSGLQWDAENGTLSFSTEHWSTYTADGEAPEVNPNSPVAEIIGPGSLLELNVS
FT                   VSDTSTVSSVVVNVSSINNTIDEAILSNNNDYWTNNSVIADVTIDGQYDLNINATDAVG
FT                   NSNSSVNCSVIMDSLPPEIEISGNFTQWQNSSALIDVSLNDDNEIAKVKWDSGDYEASH
FT                   FATNGNEISSPYDFTVTSNGSYTVYAQDAAGNENISVVHVSKIDTTDAIVIFGTNGNNT
FT                   YSNIHSTTVSASDALSGIEKLEYSWTQTEESAGSWQGFTNDAILSKEDVDGDWYLHIRA
FT                   TDNASNINHSVSNVFKFDSNSPEINAVEHPVNVNTGDTIEIGFNVTDNIGITSTEFNIS
FT                   TNDTAELTKNDNWYNYTLNVPVDSVEDIVFNATFYDDAGNLNASGDKTINVSDNIPPVI
FT                   QYIVYEEDVNTGQTTVISFNVTDNIEITSTEFNISTNDTAELNENGNWYNYTLNVPIDS
FT                   VEDIVFNATFYDDAGNYNASGDKTINVSDNIAPVIQYIVYEEDVNTGQTTVIGFNVSDN
FT                   IGITSTEFNISTNDTSELTKNDNWYNYTLNVPMDSVEDIVFNATFYDDAGNYNTSGDKT
FT                   INVSDNIKPSYNWSDKVQSANTGDNITIKINATDNIGVEMYNITVDGEEYQMKEDSGNY
FT                   THNISIPASDSGTLVSSITYNCTFGDAAGNMNSTGDVVIDVSILPIADFSANVTRGTQP
FT                   LSVEFTDNSSGLVDTWNWDFGDGNTSTNQGPSHVFGAGNFTVNLTVNNTNGTSTKYLNI
FT                   RAAYEPAYTVSPNKTELLTTYGEERNFNINSTLYSSYEWFIDGTPLNGTGVTLYNNNTD
FT                   DSAHMSYCNVNTSQYINQDDFFMDVYNVSAHVSNESLGRTDVFSWQWTVTKSSANDADD
FT                   IDQIINTIPQVNTSGNESHVRFNTSNQTSKKTGVECSIDFVSFNTSNETDDIQIKIEVL
FT                   NTSALNESEIDFSKGSVYQYMDISFNNESLVNDGSKNRSIEFKVMNNVDGGSLLIDTVY
FT                   LKHKSTSGWQSYEPELLRNDGTYSYFIVRDIPGFSPFAVTADYKYDSGSKSDDGIPAYL
FT                   KLQMLQNGSVTMDDEEIVTPEPESDSGTVQEDTTSDSSEQTTDDVPKSDEEDSSQSLFI
FT                   GIGVLALIAILVLVFKKREN"
     atggaatata aactaaatca aataagaaaa attattttgc tatccttttt aataacaatt        60
     tcactaatta taggtatttt atctttttct gtaatggcca tggctgacag tggagaagat       120
     tcctccatag gaggagtgag agctgctgaa aaagatggat gcatgttcct gggaagtgat       180
     tttattgaag tcggtatttt gcccaacggt ggatttggag cagataccaa tgctccagaa       240
     agtttctttg gctctgaacg tagtggtggt attgggcttt atgccgatct ggatggattt       300
     tacaatgata cttacgacta tcgctacgac tattttctcc ccggaagtcc ggaagaacgc       360
     tggtctgtcg gctttatgaa ggatggaacc aagtactcag attctaatgg acggaatgca       420
     ggttataata ttccaacaac aataactaat attaccaata gcaaaacagg gcacataaca       480
     gtcgatagta tctatgagga caagctggtc atcaaccaaa cttatgaact caaacccaca       540
     gaaagattcc tgaaagtaaa cgttactcta acaaatgccg gccctgatat gatggaaaat       600
     gtacgctatc agcgttcttt cgatccagat aatggggtgg atgtaggctg taattatgct       660
     actaaaaata caatcgtaag ccagcaaggt acaagtaaca aggcaatcgt aaaagcagaa       720
     ctcaaagatg gagacctcag tacagacata ggccagattt cgagcatacc catattctat       780
     tatacccagg acgaggatgc cagggtttcc tacggaagta gtggtttaat accaaataat       840
     cctccttatg gagaccttga ttgggattct gcaccatcag aaggcgatag tgtagaggct       900
     gacagctaca ttgcattgac atttaacaaa agttctcttg caccaggcca atcggtggat       960
     tatacatttt acatagggtt gactaaaaat attgatgaaa caatttcaga tgttgaagaa      1020
     gacgcaggta atacagattc atctccatct atattcaatt ccacacctga agcttttttc      1080
     atcaataatg atggaaccaa tagggatgta aatacgaatt tcacttttgc ctatagcggg      1140
     gaaaacgtca gtctcatgac ccaattgaat aacagttcag taacagcagt aaccgcgaac      1200
     ttttcgacta taccaggtga acctgccgga cagattcctt tcgaatatca tggcgagggc      1260
     atttttactc ttctcaatca tacgcttcct gactcagagc cgggaatata ttacatcacc      1320
     attctggcaa attcatctgg gcagatgaat tctacaatat gccctgtaat gttaaacttc      1380
     aacccgaaaa cagatatttc cgggctggca aatccaaaca ctactgactg gacaacaatc      1440
     gatgatctta ccaatgtaag taaccttaca tttgaagcaa atgatggcaa tggtaatgta      1500
     attggaagca tggaatttac ggaaaccgta aatctctgtg acattgagtt cgctcagaaa      1560
     ttgcagcaat tcggtgaata tgtaaatttt gccacagcac agacaacgct ggattctgaa      1620
     aacctgagca gattgaatgt ttccagcaat cttacaatgc gaggactcga atcctttgac      1680
     agccagccgg gcatactgct caacgaccag cccatcctgc aaacaggaca gacatccaat      1740
     ggttcggtgt ctggtcttca atgggatgca gaaaatggta cactgtcttt cagcacagaa      1800
     cactggtcaa catatacagc cgatggtgaa gcacctgaag taaatccaaa ttcacccgta      1860
     gcagaaataa taggacccgg aagcctcctt gaactgaacg tttcggtaag cgatacatct      1920
     actgtatcct cggtagttgt caatgtctcc agcataaata acacaatcga tgaggccatt      1980
     ttaagcaata acaatgacta ttggaccaac aattctgtta ttgctgatgt tacaattgac      2040
     ggccagtatg atctgaacat caatgcaaca gatgctgtcg gcaattccaa cagtagcgta      2100
     aactgttcag taatcatgga ttcactccct cctgaaatag aaatttccgg caatttcacc      2160
     caatggcaga attccagtgc actaattgat gtaagtctca atgacgataa tgaaattgca      2220
     aaggtaaaat gggatagcgg agattatgaa gcaagccatt tcgcaacaaa tggtaacgag      2280
     atttcttctc cctatgattt tactgtaaca agcaatgggt catacacggt atatgcacag      2340
     gatgctgcgg gtaatgagaa cataagtgtg gttcatgttt ccaaaataga tactactgat      2400
     gcaatcgtta tttttggaac caatggcaac aatacttatt ctaacattca cagcacaaca      2460
     gtaagtgcaa gtgatgcact ttcaggtatt gaaaaacttg agtattcctg gacccaaaca      2520
     gaagaatctg ccggtagctg gcaagggttt accaatgacg ctattttgag taaggaggat      2580
     gtcgatggag actggtattt acatatcaga gctaccgaca acgccagtaa tatcaaccat      2640
     tctgtatcca atgtattcaa atttgatagt aattctcctg agatcaatgc tgtagaacat      2700
     cctgtaaacg tcaatacagg tgatactata gagattggtt tcaatgtaac agataacatt      2760
     ggaattacta gtacagagtt caacatttca actaacgata ctgctgaact cacaaagaac      2820
     gataactggt acaactatac cctgaatgtc ccagtggatt cagtggagga catcgtcttc      2880
     aacgctacct tctatgacga tgcaggtaac ttgaatgcaa gtggtgacaa aaccatcaat      2940
     gtctccgata acattcctcc tgtgatccag tatatcgttt atgaggaaga tgtcaataca      3000
     ggccagacta ctgtgattag tttcaatgta acagataaca ttgaaattac tagtacagag      3060
     ttcaacattt caactaacga tactgcagaa cttaacgaaa atggaaactg gtacaactat      3120
     accctgaatg tcccaattga ttcagtggaa gatattgtat tcaacgctac cttctatgat      3180
     gatgcaggta attacaatgc aagcggtgac aagacgataa atgtttcaga taacatcgct      3240
     cctgtgatcc agtatatcgt ttatgaggaa gatgtcaata caggccagac tactgtgatt      3300
     ggtttcaatg tctctgataa cattggaatt accagtacag agttcaacat ttcaactaac      3360
     gatacttctg aactcacaaa gaacgataac tggtacaact ataccctaaa tgttccaatg      3420
     gattcagtgg aggacattgt cttcaatgca actttctatg acgatgcagg taattacaat      3480
     acaagcggtg acaagacgat aaatgtttca gataacatta aaccatccta caactggtcc      3540
     gacaaagtgc aatcagccaa tactggagac aatatcacca tcaaaatcaa cgccaccgat      3600
     aacatcggag ttgaaatgta caatatcaca gtggatggtg aagaatacca gatgaaggaa      3660
     gattctggaa attatacaca caacatctcc ataccagcaa gcgattcagg tacacttgtc      3720
     agctccataa cctacaactg tacctttggt gatgctgcag gaaacatgaa cagtactggt      3780
     gatgttgtaa tcgatgtatc aatcctgcct atcgctgatt tctcggccaa tgtaacccgt      3840
     ggcacacaac ctttgagtgt ggagtttacc gataattcct caggtctggt tgatacctgg      3900
     aactgggatt ttggtgatgg caatacttcc accaaccagg gtccttcaca tgtatttggt      3960
     gcaggcaact tcactgtaaa cctgaccgtg aataatacaa atggcacctc taccaaatat      4020
     ctcaatatca gggctgccta tgaaccagca tatacagtat ctccaaataa aacagaactt      4080
     cttacaacat atggagagga gaggaatttc aatataaaca gtacactgta ttccagttat      4140
     gaatggttca ttgacggtac accgttgaat ggtaccggag ttacactgta caacaataat      4200
     accgatgact ctgcacacat gtcttattgc aatgtgaata ccagccagta cattaatcag      4260
     gacgatttct tcatggatgt gtacaatgtc tcggcacatg tcagcaatga aagtcttgga      4320
     aggacggatg ttttctcctg gcaatggact gtaacaaagt catcggccaa tgatgcagat      4380
     gatatcgatc agataatcaa tacaatccca caggtcaata catccggtaa tgaatcgcat      4440
     gtacgtttca ataccagcaa ccagacttcc aagaaaacag gagtggaatg tagtatagat      4500
     ttcgtatcct tcaatacgag caatgaaacc gatgatattc agatcaagat cgaagtactg      4560
     aatacttctg cactcaatga atctgagatt gatttttcga aaggttcagt gtatcagtac      4620
     atggacatca gtttcaataa tgagagtctt gttaatgatg gaagcaagaa caggagtatt      4680
     gagttcaagg tcatgaataa tgtggatggt ggctcgcttc ttattgatac agtctatctg      4740
     aagcataaga gtacttctgg ctggcaatcc tatgagcctg aacttctcag aaatgacggc      4800
     acttattcct acttcattgt cagggatatt ccaggattct caccctttgc agtaactgca      4860
     gactataagt atgattcagg ttccaaatct gatgacggta ttcctgccta tctcaagtta      4920
     cagatgcttc aaaacggatc tgtgacgatg gatgatgaag agatcgtaac tccggaacct      4980
     gaaagtgaca gtggtactgt gcaggaagat acaacatccg attcatccga acagaccact      5040
     gacgatgttc caaaatccga tgaagaagac agtagtcaga gtctgttcat cggaatagga      5100
     gtattggcat taattgcaat acttgtgctg gtctttaaga agcgagaaaa ctaa            5154
//

If you have problems or comments...

PBIL Back to PBIL home page