(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE112

CP001994.PE112       Location/Qualifiers
FT   CDS_pept        143732..144616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0114"
FT                   /product="Protein of unknown function DUF1616"
FT                   /note="COGs: COG4743 membrane protein; InterPro IPR011674;
FT                   PFAM: Protein of unknown function DUF1616; SPTR: Q12UJ0
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1616)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35650"
FT                   /db_xref="GOA:D5E8Z9"
FT                   /db_xref="InterPro:IPR011674"
FT                   /db_xref="InterPro:IPR014495"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Z9"
FT                   /protein_id="ADE35650.1"
FT                   /translation="MADIKKIPVDIRIVVGLVLLTGVFILIPPLSDSAIRTVLGLPMVL
FT                   FLPGYALIAALFPKNDDLDGIERVALSFGLSIAVVPLIGLGLNYTPWGIRLMPILISLS
FT                   IFTIGMCIIAVIRRSNLAEEEAFYVPFRQSYESLKNEFHSESRSRLDRALTIILIISIL
FT                   ASVVTLVYVVVTPKQGEQFTEFYILGAGGMADDYPVNYTLGDSGKVIIGVVNHEYENVN
FT                   YTVDIQLENQSLQTIQQVNLEHNQTWQQPVTVTPPFNGTDMKLQFLLYKNGNYTESYRD
FT                   LHLWINVSEDTNE"
     ttggcggata taaaaaaaat ccctgttgac atacggattg ttgtaggcct ggtactcctg        60
     acgggagtat ttattctgat acccccactc agcgattcag ccatacgtac cgttctgggc       120
     ctgcccatgg tattgttcct gcccgggtat gcactgatag cagccctgtt ccccaaaaat       180
     gatgacctgg atggcattga acgtgtggct ttgagttttg gtctgagtat tgcagtggtg       240
     cctttgatag gtctgggtct gaactataca ccctggggta tccgcctgat gcctatcctg       300
     atttcattat ccattttcac aatcggtatg tgtatcatag ccgtgatacg ccgctccaat       360
     ctggcagagg aggaagcatt ttatgtaccc ttcaggcaat cctacgagtc tctcaaaaac       420
     gaattccatt ccgaatcccg gtcccgcctg gacagagcat tgacaataat cctgataatt       480
     tctattctgg cttcggtagt gaccctggtc tatgtggtag taacccccaa acagggagaa       540
     cagttcaccg aattctatat cctgggagca ggaggtatgg cagatgacta tccggtcaat       600
     tatactctcg gagacagtgg aaaggtaatt atcggagtgg taaatcatga atatgagaac       660
     gtcaattata ctgttgacat ccagctggaa aatcaatccc tgcaaaccat acaacaggta       720
     aaccttgagc ataaccagac ctggcagcaa cctgtcacgg taaccccgcc gtttaacggc       780
     acggacatga aactacagtt tttgctttac aagaacggta actacacaga atcttacagg       840
     gacctgcatc tctggatcaa tgtatcggag gatacaaatg agtga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page