(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE116

CP001994.PE116       Location/Qualifiers
FT   CDS_pept        complement(146380..148383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0118"
FT                   /product="PKD domain containing protein"
FT                   /note="COGs: COG3291 FOG: PKD repeat; InterPro
FT                   IPR000601:IPR013838; KEGG: sfu:Sfum_0807 hypothetical
FT                   protein; PFAM: PKD domain containing protein; SMART: PKD
FT                   domain containing protein; SPTR: Q12UI7 Putative
FT                   uncharacterized protein; PFAM: PKD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35654"
FT                   /db_xref="GOA:D5E903"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR026371"
FT                   /db_xref="InterPro:IPR026453"
FT                   /db_xref="InterPro:IPR026595"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D5E903"
FT                   /protein_id="ADE35654.1"
FT                   /translation="MRELKHSIFVLLLLIASTALIISGSAGAATNDDVIMEMTVDDSTF
FT                   NFANHESDIDGNWIQLQGGEAFQLPSPMSFTYNGVNNTSFTKKGINISIDLNVDEYSDH
FT                   KIIYPYETHPMYVTGDDVSFTFDGSESFADKDVEVSLIKTNASGLYSAIDKLMDGEKDD
FT                   IANLMNSDKNPKNRTLDEKGDCFVNYGSLDPADYIIVIIEDDPTNPLLSATAFTVLDHD
FT                   STTEVKDTENGKEVTVSMPNANKSDYIYEAIYIEESEYIEESEYRAEGYMQYNGSRDGL
FT                   NASVNGVPLLEGLSLTGIDFSNPASSDFKDKITASAGDNKVVIENVSTSETSAILNLNT
FT                   TGLDEGDYILFTMVRSGGDLLAFNQYPPVSAEEEEDDSVGGSSGGGNSGAAVSAEPYRN
FT                   VEQREAHGQFIAMNTRAEYNFAQGSTPVDSIIITPLINAGYTSVLVEVLKDTSTRVDTQ
FT                   PPGLIYSNLNILIGSRITEEGIEQATISFGVDKTWLDENDLDPSNIRLLRYTTQWTPLS
FT                   TTMTGEDEDKVYYTAETPGFSSFAIVADTDSAPVTEPADTEADFTATPVEGQSPLEVTF
FT                   TAEADNIDSWQWDFGDGNTSTQQNPTHTYEEPGTYTVVLTVEGEGGVDVVEKTDLIEVT
FT                   EPGKEEGIPGFEAVFAIAGLLAVAGLLRRRKL"
     atgagggaac taaaacatag catctttgta ttacttttac ttatagcatc aactgcattg        60
     ataatttctg gatctgcagg agcagcaacc aacgacgatg tcattatgga aatgacagtg       120
     gatgacagca cgtttaactt tgccaaccac gagtctgata tagacggcaa ctggatacaa       180
     ttacagggcg gagaagcatt ccagttgcca tctcccatgt cttttaccta taacggagta       240
     aataatactt cattcacaaa aaaggggatt aatatcagta ttgatctgaa tgtggatgaa       300
     tactctgacc acaaaatcat ctatccatac gaaacacatc caatgtatgt cactggtgat       360
     gatgtatcat ttacctttga tggttcagaa tcttttgccg ataaagatgt ggaagtatcg       420
     ttgatcaaaa caaatgcttc cggattgtat tcggctattg ataagctgat ggatggagag       480
     aaagacgata ttgcaaattt gatgaattct gacaaaaatc ctaaaaatag aacccttgac       540
     gagaaggggg attgctttgt gaactatgga tctcttgatc ctgctgacta tataatagtt       600
     atcatagaag atgatcccac aaatccatta ctctccgcca ccgcattcac ggttttagac       660
     catgattcca ctacagaagt gaaagacact gaaaacggaa aagaagttac tgtcagtatg       720
     ccgaatgcca acaaatcaga ttatatctat gaggcaatat acattgaaga aagtgaatac       780
     attgaagaaa gtgaatacag ggcagaagga tatatgcagt acaacggaag cagagatggg       840
     ctcaacgcat ccgtaaacgg cgtacccctt cttgaagggc tgtctctgac aggaattgat       900
     ttctccaatc cagcatcatc tgattttaag gataaaatta ctgcaagcgc cggagataat       960
     aaagttgtca tagaaaatgt aagcacatct gagaccagtg caatcctgaa tctgaatacc      1020
     acaggacttg atgaaggcga ttatatccta tttacaatgg tcagatcagg aggagatctg      1080
     cttgccttca accagtatcc tcccgtatct gcagaagagg aggaggatga ctctgtcgga      1140
     ggcagcagtg gtggaggcaa cagtggagct gctgtaagtg cagaacccta ccgaaacgtt      1200
     gaacagagag aagcacacgg tcaattcata gccatgaata cccgggcaga atacaatttc      1260
     gctcaaggca gtaccccggt ggattcaata ataatcaccc cgctgatcaa tgcaggttac      1320
     accagtgtgc tggtagaggt acttaaagat acctccacac gggttgatac ccagccaccc      1380
     ggactcatct acagcaatct taacatcttg attggttcca gaattaccga agagggaatc      1440
     gaacaagcaa caatttcctt cggcgtggat aaaacctggc tggatgaaaa tgatttggac      1500
     ccttcaaaca tcaggttgtt aagatacacc acacaatgga cacccctttc aaccacaatg      1560
     acaggagaag atgaagataa ggtgtactat actgcagaaa caccgggctt ttccagtttc      1620
     gcaatcgtgg ctgatacgga ttctgcaccg gttacagaac cagcagacac agaagcggac      1680
     ttcacagcaa ctcctgtaga aggacagagt ccattggaag tcacctttac agcagaggca      1740
     gataatattg actcctggca atgggacttc ggtgacggca atacatccac acaacaaaac      1800
     cccacacaca cctatgaaga accgggaacc tacactgttg tgctgacagt tgaaggcgaa      1860
     ggtggagtcg atgttgtgga gaagacagac ctgatcgaag taaccgaacc tggaaaagaa      1920
     gagggaatcc caggatttga agcagtcttt gccattgctg gattgctggc agtagcaggc      1980
     cttttgagaa ggaggaaact gtaa                                             2004
//

If you have problems or comments...

PBIL Back to PBIL home page