(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE12

CP001994.PE12        Location/Qualifiers
FT   CDS_pept        complement(11913..12953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0012"
FT                   /product="elongation factor Tu domain 2 protein"
FT                   /note="COGs: COG3276 Selenocysteine-specific translation
FT                   elongation factor; InterPro IPR004161; KEGG: dar:Daro_1810
FT                   selenocysteine-specific translation elongation factor SelB;
FT                   PFAM: elongation factor Tu domain 2 protein; SPTR: Q12V79
FT                   Elongation factor Tu, domain 2; PFAM: Elongation factor Tu
FT                   domain 2; Elongation factor Tu GTP binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35550"
FT                   /db_xref="GOA:D5E8P1"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P1"
FT                   /protein_id="ADE35550.1"
FT                   /translation="MTKIAIIGSEGSGRTSLAAKLGKKSTAADITMYDYAKNDVVMTTI
FT                   DANGYPKSVKPLVTALQLSDIALLCIPPEGPDAFAGECIMALDLMQYKHGIVVLTKADT
FT                   SYPYAQEELQKNLQKILSPTTLANWEFVNLSTESFEGLDEIKEKIFELDEQVNSEYEEL
FT                   NDKPVRIIVDQSFNVTGIGCVVLGIVKQGTVNAKEKLTAYPADKPLEVRSIQMHDEDVK
FT                   SAPAGARVGLALKGVQSKDIERGFIISEKEEVAESLVLECTLSSFASPLKLSDVPHIFT
FT                   GLQSSPMRIEKIEIDGKEAEQVNASQQCTLHLNGSHEIAYRQQDRFIITNLDAKQRFTG
FT                   YGFVKE"
     atgactaaaa tagcaattat cggaagtgag ggaagcggca ggacttccct ggcagcaaaa        60
     ctgggtaaaa aaagcacagc tgcagatatc accatgtatg attatgccaa gaacgatgtg       120
     gtgatgacaa caatcgatgc caacggttac cccaaatccg tcaaacccct tgtcactgcc       180
     ctgcaacttt ccgacatagc cctgctctgc attccaccgg aaggccctga tgcctttgcc       240
     ggggaatgta tcatggccct ggacctgatg cagtacaaac acgggattgt ggtgctcacc       300
     aaagctgata cctcataccc ttacgcccag gaagagctgc agaaaaactt acagaaaatc       360
     ctgtccccga ctaccctggc aaactgggaa tttgtaaacc tgtccaccga gtccttcgaa       420
     gggctggatg agatcaagga aaagatcttt gaacttgacg agcaggtcaa ttctgaatat       480
     gaagaactca acgataaacc cgttcgcata atcgttgacc aatccttcaa tgtcacggga       540
     attggctgtg tggtactggg aattgtgaaa cagggtacgg tgaatgcaaa agaaaaactg       600
     acagcctatc ctgcagacaa acccctggaa gtaaggtcta tccagatgca tgacgaagat       660
     gtaaaaagtg ctcctgcggg tgccagggtc ggccttgccc ttaagggtgt ccagtcaaag       720
     gatattgaaa ggggtttcat tatttctgaa aaggaagagg ttgctgaatc cctagtactg       780
     gaatgtaccc tttcctcctt tgcttctcct ctcaagctat ccgatgtacc tcatatcttc       840
     acaggcctgc agtcatcgcc catgcgtatt gagaagatcg agattgatgg aaaggaagcc       900
     gagcaggtaa atgccagtca gcaatgcaca cttcatttga atggctccca cgaaatagcc       960
     tacaggcagc aggacaggtt cataatcacg aacctggatg caaaacagcg gtttacaggt      1020
     tacggctttg ttaaagagta a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page