(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE121

CP001994.PE121       Location/Qualifiers
FT   CDS_pept        153144..155615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0123"
FT                   /product="Oligosaccharyl transferase STT3 subunit"
FT                   /note="COGs: COG1287 membrane protein required for N-linked
FT                   glycosylation; InterPro IPR003674; KEGG: geo:Geob_1424
FT                   oligosaccharyl transferase STT3 subunit; PFAM:
FT                   Oligosaccharyl transferase STT3 subunit; SPTR: Q12VP3
FT                   Transmembrane oligosaccharyl transferase; PFAM:
FT                   Oligosaccharyl transferase STT3 subunit; TIGRFAM: ATP
FT                   synthase subunit 6 (eukaryotes),also subunit A
FT                   (prokaryotes)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35659"
FT                   /db_xref="GOA:D5E908"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="InterPro:IPR026410"
FT                   /db_xref="InterPro:IPR041154"
FT                   /db_xref="UniProtKB/TrEMBL:D5E908"
FT                   /protein_id="ADE35659.1"
FT                   /translation="MTIDYKDKLKSSFLPFTGILLCFLIALYIRTIPAESVFIGENFVR
FT                   FGGNDPWYHLRNVESILHNFPSMLWFDAYTQYPYGTDQVFAPLFDMFLATIIWIIGMGN
FT                   PSTELTHTICAYYPSLLGAVIVIPVYFAAKWIFGDRRIGLLAAFLVAIAPGQFLSRSII
FT                   GFNDHHVAEALLSTVVAMFLIFGLKRSEEHDLSLASLKENGLAQIKPILPYFLLSGFFL
FT                   GAYTLTWKGALFFSFIIGVYITAQHIIDHMHGRSSEYLAIGGMAIFGVALIMVLLAPEI
FT                   GGTKSRQIFGLAAGLVAFPLLSVLSYYMKEKQLSRYYYPLSVAALFGGGILLARMFSES
FT                   AYALVSSVFSYFMRTGGGLTIAEASPLLMRSGEFTLQPLWYNFGITAIVSFFALLILAY
FT                   IAIYRRNNREQTFLIVWTVMIIWAMLQQNRFAYYYSVNAAILSAYIGIKVLDLAGWKDI
FT                   RSPFAETTSNISGWFKQIKPVHALALVLVVLVLAYPSYDLSMQQNQGTGGPNGYWIEAT
FT                   QWMKYNTPDPGLDYYESYEKPPEGQLFSYPDEAYGVMSWWDYGHWLEVIGHRIPNANPF
FT                   QQGIGGRRNSMDEENRPGASTFFTASSEAEATAVLEAVHPDPEKAGARYVVSDVEMATG
FT                   KFYAMAAWTLDTDNYYVQAQTNQGTQTVPGERYFNTMEARLHLFDGDGLTQYRMVHETP
FT                   AANTAEAGYKQVYNALFDGNIEVVNTGYVKIFEYVDGATITGQAPEGEKVTITNTIRTT
FT                   TGRTFEYSRSTTATDGTYEFVVPYSTEGPVQGQTQFDTAPTGSYEVSFGDTTESVRVSE
FT                   SAVLNGGEIEV"
     atgacaatag attataaaga caaactaaaa tcttcctttt tgccctttac gggaattctt        60
     ctgtgtttcc tgatagcact gtacattaga acaatccctg cagaaagcgt atttatcggc       120
     gagaacttcg tgcgtttcgg tggtaacgat ccctggtatc acctgagaaa tgtggaatcc       180
     attctgcata atttcccctc tatgctctgg tttgatgcct atacccagta tccttatggc       240
     actgatcagg tctttgcccc tctctttgac atgttccttg ccacaattat ctggataatt       300
     ggcatgggaa acccctccac tgaactcacc catacaatct gtgcctatta tccgtccctg       360
     ctgggtgctg tgatcgttat ccctgtatat tttgcagcca aatggatttt tggtgacaga       420
     cgtatcggtc tgcttgccgc tttccttgtt gccatcgcac cgggtcaatt cctctcccga       480
     tccattattg gattcaatga tcatcatgtt gcagaagccc tgctcagcac ggttgttgcg       540
     atgtttctga tctttggcct gaaacgcagt gaagaacatg atttgagtct ggcttccctg       600
     aaggaaaacg gactggcaca gatcaaacct attctcccct atttcctcct ttccggcttc       660
     ttcctcggcg cctacaccct cacatggaaa ggagccctgt tcttcagttt cataatcggt       720
     gtatacatca cagcccagca catcattgac catatgcatg gccgatccag tgagtatctg       780
     gccatcggtg gcatggcgat ctttggtgtg gcacttatca tggtactgct tgcacctgaa       840
     attggtggta ccaaatcccg acaaatattc gggttggcag cgggccttgt ggctttcccc       900
     cttctctctg tgctgtcgta ctacatgaaa gagaaacaac tcagtcgcta ctactatcca       960
     ctctctgtag cagccctttt cggcggaggc atcctgctgg cccgcatgtt ctctgaatcc      1020
     gcttatgctc tggtttccag cgtcttcagt tacttcatgc gcacaggcgg cggcctcacc      1080
     atcgccgaag cctccccact cctgatgcgc agcggtgaat tcaccttaca acccctctgg      1140
     tacaacttcg gaatcacggc tatagtctcc ttctttgccc tgttgatcct ggcctacatt      1200
     gccatctatc gtcgcaacaa ccgggagcag accttcctga tcgtctggac cgtaatgatc      1260
     atctgggcca tgctgcagca gaaccggttt gcctactact actcggtcaa tgcagccatc      1320
     ctttcggcat atatcgggat caaagtgctg gacctggcgg gctggaaaga tatcaggagt      1380
     ccttttgctg aaacgacatc caatataagt ggctggttca aacagatcaa accggtacat      1440
     gcattggcac ttgtactggt ggtgcttgta ctggcctatc cgtcctacga cctctccatg      1500
     cagcagaatc agggcacagg agggcccaat ggctactgga tcgaggcgac gcagtggatg      1560
     aaatacaata cgccggatcc cggtctggat tattatgaaa gctatgaaaa gccgcccgaa      1620
     ggtcaacttt tctcctatcc cgatgaagca tacggtgtga tgtcctggtg ggactacggc      1680
     cactggcttg aagtgatcgg ccacaggatt cccaacgcca accccttcca gcagggtatc      1740
     ggtggccgac gcaatagtat ggatgaagag aacagaccag gtgcatccac cttcttcact      1800
     gcctcctcag aagcagaggc cacagcagta ctggaagccg tacaccccga tcctgaaaag      1860
     gcaggggcac gttacgtggt ctccgatgtg gagatggcca ccggtaaatt ctatgccatg      1920
     gctgcctgga ccctggatac cgataattac tatgtgcagg cccagaccaa ccagggtacc      1980
     cagactgtac ccggagagcg ctatttcaac accatggaag cccggctgca cctctttgac      2040
     ggcgatggtc tcacacagta ccgtatggtg catgagaccc cggctgccaa taccgcagag      2100
     gccggttaca agcaggttta caatgccctc tttgacggca atatcgaagt ggttaatacc      2160
     ggttatgtga agatcttcga gtatgtggac ggtgccacca tcaccggaca ggcacctgaa      2220
     ggagaaaagg tgaccatcac aaataccatc cgcacgacca ccggcaggac ctttgagtac      2280
     tcccggtcca ccacggccac agatgggacc tatgaatttg tggtgcccta ctcaaccgag      2340
     ggtccggtgc agggacagac ccaattcgat accgcaccca caggttccta cgaggtttcc      2400
     ttcggggata ccactgaatc tgtgcgggta agcgaatccg cggtcctgaa tggtggggaa      2460
     atagaggttt ga                                                          2472
//

If you have problems or comments...

PBIL Back to PBIL home page