(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE125

CP001994.PE125       Location/Qualifiers
FT   CDS_pept        157101..157583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0127"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="COGs: COG0066 3-isopropylmalate dehydratase small
FT                   subunit; InterPro IPR000573:IPR011827; KEGG: wsu:WS1812
FT                   3-isopropylmalate dehydratase small subunit; PFAM:
FT                   aconitate hydratase domain protein; SPTR: Q12VP4
FT                   3-isopropylmalate dehydratase, small subunit; TIGRFAM:
FT                   3-isopropylmalate dehydratase, small subunit; PFAM:
FT                   Aconitase C-terminal domain; TIGRFAM: 3-isopropylmalate
FT                   dehydratase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35663"
FT                   /db_xref="GOA:D5E912"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D5E912"
FT                   /protein_id="ADE35663.1"
FT                   /translation="MIKGKAWIFGDDVDTDVIIPGKYLRTTDMQVFADHAMEGIDPDFS
FT                   SKVSPGDIIVGGNNFGCGSSREQAPLALKHAGVGCVVARSFGRIFFRNSINVGLPLIEA
FT                   DVECEEGDEVEVNLSEGTVKVAGRTYTGQQIPDFLLEILSDGGLVEHRKKQQRLNS"
     gtgattaaag gtaaagcatg gatcttcggt gacgatgtgg acaccgatgt tataatcccg        60
     ggtaaatacc tgcgtaccac cgatatgcag gtctttgcag atcatgccat ggaaggcatc       120
     gaccccgatt tttcaagcaa agtatctccc ggtgacatca ttgtcggcgg caacaatttc       180
     ggctgtggct cctccagaga gcaggcaccc ctggcactca agcatgccgg tgtgggttgt       240
     gtggttgcca gatccttcgg acgcattttt ttccgcaatt ccatcaatgt gggtttgccg       300
     ctgattgagg cggatgtgga gtgtgaggaa ggtgatgagg tcgaagtcaa cctctccgaa       360
     ggcactgtga aagtggcagg caggacctat acaggccagc agatccccga tttcctgcta       420
     gaaatactga gtgacggcgg gcttgtcgag catcgtaaaa aacaacaaag gctaaattca       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page