(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE128

CP001994.PE128       Location/Qualifiers
FT   CDS_pept        complement(159782..160486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0131"
FT                   /product="uridylate kinase"
FT                   /note="COGs: COG0528 Uridylate kinase; InterPro
FT                   IPR001048:IPR011818; KEGG: sfu:Sfum_1780 uridylate kinase;
FT                   PFAM: aspartate/glutamate/uridylate kinase; SPTR: Q12VQ2
FT                   Uridylate kinase; TIGRFAM: uridylate kinase; PFAM: Amino
FT                   acid kinase family; TIGRFAM: uridylate kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35666"
FT                   /db_xref="GOA:D5E915"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR011818"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D5E915"
FT                   /protein_id="ADE35666.1"
FT                   /translation="MLVVISIGGSILARDLDPERFAKYADMLEELSKEHSVVVVTGGGV
FT                   AARQYIEAARQVGANEVTCDFIGIDVTRLNAQLLIAALGKNAYPEPPQSYRDAELALSS
FT                   GKIIVMGGVIPGQTTDTVSAVLAEYLGAELMVIATSVDGVYSKDPTTSNDAEKFDVMSP
FT                   KELLDVVMSTEMKAGSKSPVDPLAAKIIERCNIETIVMDGSSEGDIYKVVMQEKIKSEP
FT                   VEGERVGTRIKS"
     atgctagtag taatatcaat aggcggatcc attcttgcca gggacctgga tccagagagg        60
     ttcgcaaaat acgccgatat gctggaagag ctttcgaaag aacattccgt ggtagtcgtg       120
     accggtggag gtgttgccgc ccgccagtac atagaagctg ccagacaggt cggagcaaat       180
     gaggtcacct gtgattttat agggatcgat gttacccgtc tcaatgccca gctcctcata       240
     gctgccctgg gcaagaatgc atatccagaa ccacctcaga gttacaggga tgcagaactt       300
     gccctttcct ccggcaaaat cattgtaatg ggaggtgtaa tcccgggaca gaccacagat       360
     acggtctccg cagtacttgc cgagtatctg ggagctgagt taatggtgat tgcaacttcc       420
     gtggacggcg tatattcaaa agacccgaca acatccaatg atgctgaaaa atttgatgtg       480
     atgagtccca aagagctgct tgatgtggta atgtccactg aaatgaaagc cggttcaaaa       540
     tcccctgtag atcccctggc tgcaaagata atcgagagat gcaatattga aacaatcgtt       600
     atggatggtt ccagtgaagg ggatatttac aaagtcgtaa tgcaggaaaa aataaagagt       660
     gaacctgtcg aaggagaacg tgtgggtaca cggatcaaga gctga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page