(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE13

CP001994.PE13        Location/Qualifiers
FT   CDS_pept        complement(13001..14167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0013"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="COGs: COG1423 ATP-dependent DNA ligase homolog of
FT                   eukaryotic ligase III; InterPro IPR001072:IPR012310; KEGG:
FT                   aeh:Mlg_2553 ATP dependent DNA ligase; PFAM: ATP dependent
FT                   DNA ligase; SPTR: Q46DV0 Putative uncharacterized protein;
FT                   PFAM: ATP dependent DNA ligase domain; TIGRFAM: conserved
FT                   hypothetical protein TIGR01209"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35551"
FT                   /db_xref="GOA:D5E8P2"
FT                   /db_xref="InterPro:IPR001072"
FT                   /db_xref="InterPro:IPR021122"
FT                   /db_xref="InterPro:IPR041596"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P2"
FT                   /protein_id="ADE35551.1"
FT                   /translation="MKGSEKPELDMEKTARFLGLSVSRLERLLEKRLLSRNWGKYKNLF
FT                   RFETSVSGIERGSVLLQKRDGELDLILGFPKIQRAMLLEPSINNHFSEIDKLIVEEKMN
FT                   GYNVRVIENAGKLIAFTRSGHVCPYSTEKVNYLLDPSFFRQYPDLVVHGEMAGPENPYV
FT                   SKKVYDTQTLDFFVFDIRHKKTGQPLPVIQRRKLAASFGFKQVPFLGEFARKEAAEKIM
FT                   SIIKKLGDMGHEGVVIKDLDMDLSPIKYTCSESNCADLEHAFKFYNEVGRDYLYSRVVR
FT                   EGFQTVEWDEDEDTMEKRCLRLGKSILSPMADSVRRVGNGEKLYDEVTLRFQNPQTLQE
FT                   FEEYFRRLGIDAIFDRVGYSGGELMVNLQKLNQSTTDKTESMWEGNLW"
     atgaaaggtt cggagaaacc agaacttgat atggaaaaga cagcccgctt tttagggctg        60
     tcagtctcca gactggaaag actacttgaa aaaagactcc tgtcaagaaa ctggggaaag       120
     tacaagaatt tgttcaggtt tgaaacctcc gtctcgggta tagaaagagg aagtgtcctc       180
     ctgcaaaaac gcgatggaga actggattta atcctgggtt tcccgaaaat acagcgcgca       240
     atgctgcttg agccttccat aaataaccat ttttcagaaa ttgataaact catagtcgaa       300
     gaaaagatga acggctataa tgtccgtgta attgaaaacg cagggaaact tatcgctttt       360
     acacgcagtg ggcatgtctg tccctattcc acagaaaaag tcaattatct tttagacccc       420
     tcctttttca gacaatatcc tgatcttgta gtgcacgggg aaatggcagg ccccgagaat       480
     ccttatgtct ccaaaaaggt ctacgataca cagacactgg attttttcgt cttcgatata       540
     cgccacaaaa agactggaca gcccctgccg gtcatacaaa gaagaaaact ggccgcatcc       600
     tttggtttta agcaggttcc tttcctggga gagtttgcaa ggaaagaggc tgctgaaaag       660
     atcatgtcca tcataaaaaa actgggggat atgggacatg aaggggtggt catcaaggat       720
     ttggatatgg atctgtcacc tatcaaatat acatgttcag agagtaattg cgccgacctt       780
     gaacatgctt tcaagttcta taatgaagtg gggcgggatt atctgtattc cagggtagtc       840
     agggaaggtt tccagaccgt ggaatgggat gaggatgaag acacaatgga gaaacggtgc       900
     ttaaggcttg gcaaaagcat cctctctcct atggccgatt ctgttcgaag ggttggcaac       960
     ggtgaaaaac tctatgatga ggttacattg cgtttccaga atccacaaac cctgcaggaa      1020
     tttgaggaat atttccgacg acttggcata gatgctattt ttgaccgggt tggatattca      1080
     ggaggagaac ttatggtaaa cctacaaaaa ctcaaccaga gtaccaccga caagaccgaa      1140
     tcaatgtggg aaggcaacct gtggtga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page