(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE132

CP001994.PE132       Location/Qualifiers
FT   CDS_pept        164015..164974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0135"
FT                   /product="beta-ribofuranosylaminobenzene 5'-phosphate
FT                   synthase"
FT                   /note="COGs: COG1907 sugar kinase; InterPro
FT                   IPR013750:IPR006204:IPR004422; KEGG: mmb:Mmol_1347
FT                   beta-ribofuranosylaminobenzene 5'-phosphate synthase
FT                   family; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   SPTR: Q12VQ8 Beta-ribofuranosylaminobenzene 5'-phosphate
FT                   synthase; TIGRFAM: beta-ribofuranosylaminobenzene
FT                   5'-phosphate synthase family; PFAM: GHMP kinases C
FT                   terminal; GHMP kinases N terminal domain; TIGRFAM:
FT                   beta-RFAP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35670"
FT                   /db_xref="GOA:D5E919"
FT                   /db_xref="InterPro:IPR004422"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D5E919"
FT                   /protein_id="ADE35670.1"
FT                   /translation="MIEITSPSRLHLSLIDLNASLGRVDGGIGVSLQYPHIHLTAEKSD
FT                   HLEITGNSLLYDKVQSAISALLPEGEGISIYLDEDMPAHVGLGSGTQVALCTAAAINEL
FT                   FELGFSIRQLAQKVGRGGTSGIGVAAFEKGGFLVDGGHRFSDKGTFSPSSASPAPPAPI
FT                   VFRHDFPDWPIVLALPDRQGAHDAQEVDIFRQVCPVPLEDVQAISHIVLMQMIPAVIEN
FT                   DIENFGIALDSLQTLGFKKQEISLQSQQVQDVIEQMRLAGTHGVGMSSFGPAICGFVEN
FT                   ETKGKRIVREIQKFLDESIGGKVLLTTPNNTGADIRMD"
     atgatcgaga tcacatcccc ttcaaggctg cacctctctc tgattgacct taatgcttcc        60
     ctgggtcggg ttgatggggg aataggggtt agtctgcaat atccccacat acatcttacc       120
     gctgaaaaaa gtgatcattt ggagattacc ggcaattcgt tactgtacga caaagtgcaa       180
     tctgcgattt ctgccctgct gcctgaagga gaaggaatca gtatctatct tgatgaggac       240
     atgcctgccc atgtaggcct gggttcgggg acacaggtgg ctttgtgtac cgcggctgcg       300
     atcaacgagc tttttgaact gggattttcg atcagacagc tggcacaaaa ggtgggtagg       360
     ggtggtactt ccggcatcgg tgtggcggct tttgaaaagg ggggtttcct tgtggatggc       420
     gggcatcgtt tttccgataa aggcactttt tccccctcct ctgccagtcc ggccccgcca       480
     gctccgatcg ttttcaggca tgattttccg gactggccta tagtgctggc tcttcctgac       540
     agacagggag ctcatgatgc acaggaagtg gatattttca ggcaggtctg cccggtaccc       600
     ctggaggatg tacaggcgat ctctcatatc gttctgatgc agatgattcc ggctgtgatt       660
     gaaaatgata ttgagaactt tggcattgca cttgacagcc tgcagacgct gggattcaaa       720
     aaacaagaga tctctctgca gagccagcag gtgcaggacg taattgaaca gatgagactg       780
     gccggtaccc atggtgtcgg gatgagttcc tttgggcctg caatatgtgg ttttgttgaa       840
     aatgagacta aagggaaacg tattgtccgg gaaatacaaa aattcctgga tgagagtata       900
     ggaggtaagg ttttgcttac aactcccaat aacaccggtg cggatatcag gatggattaa       960
//

If you have problems or comments...

PBIL Back to PBIL home page