(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE135

CP001994.PE135       Location/Qualifiers
FT   CDS_pept        166620..166856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0138"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12VR1 Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF2769)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35673"
FT                   /db_xref="InterPro:IPR020075"
FT                   /db_xref="UniProtKB/TrEMBL:D5E922"
FT                   /protein_id="ADE35673.1"
FT                   /translation="MADQDELRQGLGKYFGVCPSYHHSKACLCKNCPSYPGEGYMFCAR
FT                   GPVSGEISQECMCNDCYVYHQFALEGDYFCREE"
     gtggcagatc aggatgaatt gaggcagggt ctgggcaaat atttcggtgt ttgtccttcg        60
     tatcatcact ccaaggcctg tttatgtaag aattgcccgt cctatccggg tgaaggttat       120
     atgttctgtg ctcggggtcc tgtatcaggt gagatcagtc aggaatgtat gtgcaatgac       180
     tgttatgtat atcaccagtt tgctcttgaa ggggattatt tttgcagaga ggaatga          237
//

If you have problems or comments...

PBIL Back to PBIL home page