(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE138

CP001994.PE138       Location/Qualifiers
FT   CDS_pept        169171..170007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0141"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro
FT                   IPR013216:IPR013217; KEGG: dal:Dalk_0866 methyltransferase
FT                   type 12; PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; SPTR: Q12US1 Methyltransferase type 12; PFAM:
FT                   Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35676"
FT                   /db_xref="GOA:D5E925"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D5E925"
FT                   /protein_id="ADE35676.1"
FT                   /translation="MLYYEIDWGNIWIEQMKLHNEADEQVQQPDRWGTYANAKRFWQSS
FT                   RKSGKRLEKALQDIKHDSDSRILDIGAGPGSMAIPLAQRVSHVTAVEPADGMTEVLKEN
FT                   IADYNLDNVTCIQKNWEDVAVEELDGMYDVIIASYSLHVPDIREALEKIQQVSNGRVYI
FT                   YWFAGPTSWDKNYSRIWPQLHGRQYYPSPKCDVLYNVLYSMGIYPDMENFELTHYTRFS
FT                   SLDEAVEHYKPHYKIANKQQEQILRSHLEEILEKEGDELVQVGRSSRVKISWDNSH"
     atgttgtatt atgagatcga ttggggcaac atctggatcg agcagatgaa attgcataat        60
     gaggcggatg aacaggttca acagccagac cgctggggaa cgtatgcaaa tgccaaacgt       120
     ttctggcaat cctcccgcaa gagtggaaaa agactggaaa aggccctgca ggatataaaa       180
     catgacagcg attcccggat actggatatc ggtgcaggcc cgggttcaat ggcaattcct       240
     ctggctcaaa gggtttccca tgtaaccgca gtggagccgg ccgacgggat gaccgaggtc       300
     ctgaaggaaa acattgctga ttacaatctc gataatgtca catgtatcca gaagaactgg       360
     gaggatgtgg ccgttgagga actggacggc atgtatgatg tgataatcgc ttcctattcc       420
     ctgcatgtac ccgatatcag ggaggcactg gaaaagatcc agcaggtaag caatggcagg       480
     gtctatatct actggtttgc aggtccgact tcctgggata agaattattc acgcatctgg       540
     ccgcagttgc acggcaggca atattatccc tctcccaaat gcgatgtgct ctataatgta       600
     ctctatagca tgggaatcta tccggacatg gaaaactttg agttgacaca ttacacccgt       660
     ttttcttccc tggatgaggc ggtggagcat tacaaacccc attataagat tgccaataag       720
     cagcaggaac aaatcctgag gtcccatctg gaagaaatac tggaaaaaga aggggacgag       780
     ctggtccagg tgggccgctc gtcaagggta aaaatatcgt gggataattc ccactga          837
//

If you have problems or comments...

PBIL Back to PBIL home page