(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE141

CP001994.PE141       Location/Qualifiers
FT   CDS_pept        complement(172602..173012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0144"
FT                   /product="Threonyl-tRNA synthetase editing domain protein"
FT                   /note="InterPro IPR015011; KEGG: sfu:Sfum_0182 hypothetical
FT                   protein; PFAM: Threonyl-tRNA synthetase editing domain
FT                   protein; SPTR: A7I9Y6 Putative uncharacterized protein;
FT                   PFAM: Archaea-specific editing domain of threonyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35679"
FT                   /db_xref="GOA:D5E928"
FT                   /db_xref="InterPro:IPR015011"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D5E928"
FT                   /protein_id="ADE35679.1"
FT                   /translation="MKMLLFDTEYFWFDTFSKTLENVEDIKKEEKIENTAVVFIHVELE
FT                   DEERKNKVVKNAVKTFKWYLNKVDKEKIVLHSFAHLSSSTSSPEFAAEIISEIKEKLIN
FT                   KGIEVHTTPFGYFSEFSIHVRGESLAKIFKEI"
     atgaagatgt tactatttga taccgaatat ttttggtttg acacttttag taagaccctt        60
     gaaaatgtag aagacataaa aaaagaagaa aaaatagaaa atactgctgt tgttttcata       120
     catgttgaat tggaggatga agagaggaaa aacaaggtag ttaaaaatgc tgtgaaaact       180
     ttcaagtggt atcttaataa agtagataaa gaaaaaatag ttttgcattc ttttgcccac       240
     ctctcatcaa gtacatcttc tcctgaattc gcagcggaaa ttatttctga aattaaggaa       300
     aaattaatca acaagggaat tgaggtccat acaacacctt ttggctactt ttctgaattt       360
     tctatccatg ttcgtggcga atctcttgca aaaatattta aagaaatctg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page