(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE142

CP001994.PE142       Location/Qualifiers
FT   CDS_pept        173464..175185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0145"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="COGs: COG0028 Thiamine pyrophosphate-requiring
FT                   protein; InterPro IPR012000:IPR011766:IPR012001:IPR000399;
FT                   KEGG: ppd:Ppro_2814 thiamine pyrophosphate binding
FT                   domain-containing protein; PFAM: thiamine pyrophosphate
FT                   protein TPP binding domain protein; thiamine pyrophosphate
FT                   protein domain protein TPP-binding; thiamine pyrophosphate
FT                   protein central region; SPTR: Q8PT77 Acetolactate synthase;
FT                   PFAM: Thiamine pyrophosphate enzyme, central domain;
FT                   Thiamine pyrophosphate enzyme, N-terminal TPP binding
FT                   domain; Thiamine pyrophosphate enzyme, C-terminal TPP
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35680"
FT                   /db_xref="GOA:D5E929"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D5E929"
FT                   /protein_id="ADE35680.1"
FT                   /translation="MEKMNGAQVLVKCLEDLGVKHVFGYTGAAILPVFHALHDSDIGIT
FT                   ISSNEQSAAFSAAGYSRSGDEIGVAMVTSGPAITNTLTGVADAYGDSIPMLVFAGQVPE
FT                   HKIGTDSFQHINVSGIFEDAAKKVIQLSNNDDIESIVKDAYYFACSGKPGPVVIDFPLD
FT                   KQQKRHEYRARDVSIFEQSYHDDRHLSDRQCAGFYELLLNSEKPLLYLGGGLNSRRGRQ
FT                   AIHAFNDYFKIPSVNTLMAKGIVDERDELNLGMLGMFGTPYANMIIQENDFFFAIGVRW
FT                   DDRIAEKVGFGIEAEIAYIDINPEKMHQIKIERFPKFTFIGDAATALGDLLAYAKRYNI
FT                   KLDIGRWQKHAAKLKQSWPLDYNRSSDRIQAAETMGMLAGFIDETMKITTGVGNHQMLA
FT                   AQYLPMQQEQSFMSSGSFGTMGFAVPTAIGVHYANPNSKVIAIDGDGSLKMNLGELHTI
FT                   ASLDLPVKILLLNNMSDGMVLNLQDVAYGGIRTGTRRTKDILFAEIARSFGFNYSKRVN
FT                   KRKELRQSLEYFLDAEGPSFLEVLTDREEILYPKVPAGCSYSDMIIGPYIKKVSSD"
     atggaaaaaa tgaacggggc gcaagttctg gttaaatgtc tggaggacct tggggtcaaa        60
     cacgtttttg gttatactgg tgcagccatt cttccggtat ttcatgccct gcatgacagc       120
     gatatcggaa taaccatcag ttccaatgaa caatctgctg ccttcagtgc agccggatac       180
     tcaagatcag gagatgaaat aggtgttgcc atggttactt caggccctgc cataaccaac       240
     actctcacag gagttgccga tgcctatggg gacagcatac ctatgcttgt atttgcaggc       300
     caggttccgg aacacaaaat agggaccgac tccttccagc atatcaatgt aagcggtatt       360
     ttcgaggacg ctgcaaaaaa ggtcattcag ctatccaaca acgatgatat tgaatcgata       420
     gtcaaggacg cctattattt tgcctgttca ggaaaacccg gtcccgtagt catagatttc       480
     ccgcttgata aacagcagaa aaggcatgaa tacagagcaa gggatgtcag tatatttgag       540
     caaagctatc atgacgatcg gcatctgagc gaccggcaat gtgcaggatt ctatgaatta       600
     cttctaaact ctgaaaaacc cctgctctat ctgggcgggg ggctcaattc cagaagaggc       660
     agacaggcta tacatgcctt taatgactat ttcaaaatac cttctgtcaa tacactgatg       720
     gcaaagggaa ttgtggacga gcgggacgaa ctgaacctgg gaatgctcgg aatgtttggt       780
     acaccctatg caaacatgat catccaggaa aatgactttt tctttgccat cggtgtccgg       840
     tgggatgacc ggattgcgga aaaggtcggt tttggaatcg aagcggaaat cgcttatata       900
     gacataaatc ccgagaaaat gcaccagatc aagatcgaac gtttcccaaa atttacattc       960
     ataggggatg ctgccactgc ccttggggat ctgctggcct atgccaaaag atacaatatc      1020
     aaactggata ttggtcgctg gcaaaaacat gcagccaaac ttaaacaatc ctggccactg      1080
     gattacaacc gtagttcaga caggatacag gcagctgaga caatggggat gctggctggt      1140
     tttattgatg agaccatgaa gattacaaca ggggtcggca atcaccagat gcttgcggcc      1200
     cagtatcttc cgatgcaaca ggagcagagt ttcatgtcct cagggtcatt cggaaccatg      1260
     ggatttgcag ttcccacagc cattggtgta cattatgcca acccgaattc aaaggtcatt      1320
     gccattgacg gggacggtag cctaaaaatg aatcttgggg aactgcatac aatagcatct      1380
     ctggacctgc cggtcaagat actgctattg aataatatga gtgacggcat ggttttgaac      1440
     cttcaggatg ttgcatacgg tggaatccgt accggaaccc ggcgaacaaa ggatattctc      1500
     tttgcagaaa ttgcccgatc ctttggtttc aattactcaa aaagggttaa taagaggaaa      1560
     gagctgcgac agtctcttga atatttcctg gatgcagaag gcccttcttt ccttgaagtt      1620
     ctcacagaca gggaagagat actttatcca aaggttcctg caggttgttc gtacagtgat      1680
     atgatcattg ggccgtatat aaaaaaagta tcctctgatt ga                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page