(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE143

CP001994.PE143       Location/Qualifiers
FT   CDS_pept        175255..176358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0146"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="COGs: COG0247 Fe-S oxidoreductase; InterPro
FT                   IPR001450:IPR004017:IPR017900; KEGG: gur:Gura_3039
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF224 cysteine-rich region domain protein; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; SPTR: Q12YM1
FT                   Putative uncharacterized protein; PFAM: Cysteine-rich
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35681"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D5E930"
FT                   /protein_id="ADE35681.1"
FT                   /translation="MYRFQEKIDSCIDCKKCWEVCPANMVTEGNLFTPQRKIGSLAKIV
FT                   AGEELTQDEMDNIYLSTRCGACDDVCPVDIPITDIIQYERELLAQQGREPAKTTAISKN
FT                   ILEHNSPGAMDPSKRFDWVTHDLEIAEESEIAYMAGCWVAYSQPDIARSTIRLLNHAGI
FT                   KPMLLKEEKCCGLFLIDNGHLEEAAEHAKKFVDYIESLGVKKVIASCPGCYLVLSREYP
FT                   DLYRELNFEVEHSLNIFKAMINDGTLKPEKLDYTVSVRDACPVRKSKDVPRDILSSMGV
FT                   EIKELFDGKQVCCGGPAGLKPNFPGISSDIAMLSVNDYKENADMLVSYCPFCMHHIGGV
FT                   CNSKDEDLDMKDISVLLAESVFGSMGE"
     atgtatcgtt ttcaggaaaa gattgattca tgtatagatt gcaagaaatg ctgggaggtc        60
     tgtcctgcca acatggtgac ggagggcaac ctttttaccc cgcagagaaa gattggatcc       120
     cttgcaaaga tcgttgcagg tgaagaactg acacaggatg agatggacaa tatttatctt       180
     tccacacgtt gcggggcctg tgatgatgtc tgcccggtcg acatccctat tactgatatt       240
     atccagtatg aaagggagtt attagcacag cagggcagag agcctgccaa gacaacagca       300
     atatcaaaaa acattcttga gcataacagt ccgggagcca tggatccttc aaagagattt       360
     gactgggtta cccatgacct tgaaatagcc gaagaatctg agatagcata tatggcaggc       420
     tgctgggttg catacagcca gcctgatata gccaggtcta ccattcgttt gctcaatcat       480
     gccggtatca agccgatgct cttgaaggag gagaaatgct gtgggctctt tttgattgac       540
     aacggccatc ttgaagaagc agcagagcat gccaaaaaat tcgtagacta tattgaatct       600
     ctgggtgtaa agaaagttat cgcatcctgt cccggatgct acctggtttt gagccgtgaa       660
     tatccggacc tttaccgtga attgaatttt gaagtggagc attcactcaa tattttcaaa       720
     gctatgatca acgatggtac actcaaacca gagaaactgg attatacggt ttctgtaagg       780
     gatgcctgcc cggttagaaa atcaaaagat gtaccaaggg atatactttc aagtatgggc       840
     gtggagataa aagaactctt cgatggcaaa caggtgtgct gcggaggacc cgcaggtctg       900
     aaacccaact tcccggggat atcatcggat attgccatgc tgtctgttaa tgattacaaa       960
     gagaatgctg atatgctggt ttcatattgt cctttttgca tgcatcatat cggcggtgta      1020
     tgtaattcaa aagatgaaga tttggatatg aaggatattt cagtattgct ggcagaaagt      1080
     gtatttggaa gtatgggaga atga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page