(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE148

CP001994.PE148       Location/Qualifiers
FT   CDS_pept        178913..181066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0151"
FT                   /product="efflux transporter, hydrophobe/amphiphile
FT                   efflux-3 (HAE3) family"
FT                   /note="COGs: COG1033 exporter of the RND superfamily
FT                   protein; InterPro IPR000731:IPR004767; KEGG: vei:Veis_2986
FT                   RND efflux transporter; SPTR: Q46D10 Transporter, RND
FT                   superfamily; TIGRFAM: efflux transporter,
FT                   hydrophobe/amphiphile efflux-3 (HAE3) family; PFAM: MMPL
FT                   family; TIGRFAM: The (Largely Archaeal Putative)
FT                   Hydrophobe/Amphiphile Efflux-3 (HAE3) Family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35686"
FT                   /db_xref="GOA:D5E935"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004767"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D5E935"
FT                   /protein_id="ADE35686.1"
FT                   /translation="MSTGTETYVDKDTKVYQDYENIYLRYLGAHSIVIMISDEDIKSPE
FT                   VLKAIDRLDQQVSDIPGVVETLHIADAVKTANYMQTGKMQVPENRNDIVVPENGETDLL
FT                   LPDNTHTLFLIQTSGNTPDVRLEKILGETEKSVLYADFPPATSVVVTGEEAFSIEMQNA
FT                   IRQAMPPLIGASALLIIIALYLTFRGVRWRVLPIFIVGIGIIYTFGAMGYIGIPMTMVS
FT                   MAAFPILIGLGIDYMIQFHNRLEEEFSSQDSEKAAVVETVKHTAPAILTAYSISALGFV
FT                   SLLTSSVPMIRDFGKMLFIGTFLCYIAAQFIGVPAIYLLARKHKKRLSGASEGNDTNSN
FT                   SGKPTVIERLLDKTTVFTVNHPVPILIIAGMLCIFGLYADQSVPVQTDEKEFVPQDMDA
FT                   LIHIDNFYKITERGESVYLVIQTGDNTDPGLIRWMDSFSEYIVDSHSNVYGSTSIVSAV
FT                   KSLNSGSIPDTNSEIAKIYDTIPQNQKASYLHGNNLLMMELSVNNDLDGEGLGNLIDYI
FT                   QEDIAWYQSPPDTEITITGSNVVFTAIIGALTTGRLLMTLLGVIMIFIGLLFVYRDWLK
FT                   ALVPVVTMFMVIGWAGGVMYYSGLSYSPMTATLGAMILGIGTEYAIHIMERYYEEKEKG
FT                   ATSIEAMRQASTKIGSAIVTSGLTTIFGFSALIVSPFLINQNFGLITVMIVFLALISSF
FT                   FVFPATLILLEKIRDRRKGSHDI"
     atgagtaccg gtacagaaac ctatgtagat aaagatacca aagtctatca ggattatgaa        60
     aatatttatc ttcggtatct gggcgctcac tctatagtga taatgatatc agatgaggat       120
     atcaaatcgc ctgaagttct aaaagctatt gacagattgg atcagcaggt ttccgatatt       180
     cccggagttg ttgagacttt gcacatagca gatgcggtca agactgcaaa ctatatgcag       240
     acaggaaaga tgcaagttcc tgaaaatcga aatgatattg tagtgcccga aaacggggaa       300
     accgatcttc tccttcctga caacactcat accctttttc ttatacagac atccgggaac       360
     accccggatg tcaggcttga aaaaattctg ggtgaaacag aaaaatccgt tctgtatgct       420
     gatttccctc cggcgacttc tgttgttgtt acaggggaag aggcattttc aattgaaatg       480
     caaaatgcaa tccgacaggc gatgccccct ctgattggtg catctgctct tcttatcata       540
     attgccctgt atctgacatt caggggtgtc agatggaggg ttttaccgat atttatagtg       600
     ggtattggaa ttatttacac atttggtgct atgggataca tcggtattcc catgaccatg       660
     gtctctatgg ctgcattccc gattcttatc gggttgggaa tcgattatat gatccagttt       720
     cataatcggc tggaggagga attttcctca caggattctg aaaaagctgc agttgtagaa       780
     acggtcaaac ataccgcacc tgccatattg acagcatata gtatcagtgc actgggattt       840
     gtatccctgc taacatcttc cgttccaatg atacgggatt ttggaaaaat gctgtttatc       900
     ggtacttttc tgtgttatat agcagcccag tttataggag tgcctgcaat ttatctcttg       960
     gccagaaaac ataagaagag attatccggc gcttctgagg gtaatgatac aaattcaaat      1020
     tccggtaagc ccacggtcat tgaacgtctt cttgataaaa caactgtatt tacagtgaat      1080
     catccggttc cgatacttat aatcgctgga atgctctgta tttttggatt gtatgcggat      1140
     cagtcggttc ctgtgcaaac agatgaaaaa gaattcgtgc ctcaggatat ggacgctctg      1200
     atacacatag ataattttta caagattacc gagagaggag aaagtgtcta tctggtgatc      1260
     caaacaggtg ataatactga tcctgggtta attagatgga tggattcttt ctctgaatat      1320
     atcgttgatt cacatagcaa tgtgtatgga tcaactagca ttgtatctgc tgtgaagtct      1380
     ctgaattcag gctcaatacc ggatacaaat agtgaaattg caaaaatcta tgatactatc      1440
     ccgcaaaatc agaaggcttc gtatttacat ggaaacaatc ttcttatgat ggaattaagt      1500
     gtaaataatg atctggatgg ggaagggttg ggaaatctta ttgattacat acaggaagat      1560
     attgcatggt atcaatctcc tccggatacg gagattacaa ttaccggaag taatgtggtt      1620
     tttaccgcta ttattggtgc ccttacaacc ggcagactgt tgatgacgct tctcggggtg      1680
     attatgattt tcatcggact gctttttgtt tatagggact ggctgaaagc tctcgtaccg      1740
     gtggtaacca tgttcatggt aattggatgg gcagggggag tcatgtatta ttccgggctt      1800
     tcctatagtc ccatgacagc taccctgggg gctatgattc ttggaatcgg aacggaatat      1860
     gcgattcata taatggagag atactatgaa gaaaaagaga aaggtgcaac atccattgag      1920
     gccatgaggc aggccagcac aaaaatagga tctgctatag ttacatccgg actcacgaca      1980
     atttttggtt tctctgcttt gatcgtttct ccctttttga tcaaccagaa tttcggtctg      2040
     attacagtaa tgatcgtgtt tctggcactg atatcctcct tttttgtatt cccggcgacc      2100
     ctgattttgc tggaaaagat tcgtgataga agaaaaggaa gtcatgatat atga            2154
//

If you have problems or comments...

PBIL Back to PBIL home page