(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE15

CP001994.PE15        Location/Qualifiers
FT   CDS_pept        complement(14982..15821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0015"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="COGs: COG3448 CBS-domain-containing membrane
FT                   protein; InterPro IPR000644; KEGG: sme:SMc00815
FT                   inositol-5-monophosphate dehydrogenase; PFAM: CBS domain
FT                   containing protein; SMART: CBS domain containing protein;
FT                   SPTR: Q12V76 CBS domain protein; PFAM: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35553"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P4"
FT                   /protein_id="ADE35553.1"
FT                   /translation="MNVSDIMSAPVYVIGTEEPVSHARKLMFRHKISTLIVVEEDEIKG
FT                   IVTKSDISSRLAQAEPMWRRRPIDKIPAKMVMTAEPIITIYPDASVSQAINLMLENQIN
FT                   NLPVFKNKLQGIVTIGDIVRYVADRALTTKISEVLTDDAVEVHRHHTINHVIDEMEKHR
FT                   VSKVIVINDMGDTVGMISTRDIALSAMEDNEGKMQSKNIKMARKPTQGGEKTYRYVKDV
FT                   PLVAEDIMVELDGVVNIEDNLSDAAKVMVENNRTGLPVEKEGKIVGILSRIDIIRAA"
     atgaatgtat cggatataat gagtgctccg gtctatgtga ttggaacaga ggaacctgta        60
     tcacacgcaa ggaagctgat gtttcgtcac aagatcagta ctttgatagt tgttgaagag       120
     gacgaaataa agggaattgt cacaaaaagt gatattagca gccgccttgc acaggcagaa       180
     ccaatgtgga ggcggcgccc catcgataag atcccggcaa aaatggtgat gaccgcagaa       240
     ccgattatca ctatttatcc cgatgcatcc gtatcccagg ccattaacct gatgctggaa       300
     aatcagatca acaacctgcc ggtgttcaag aacaagcttc agggaatcgt aacaatcggg       360
     gatatagtcc gttatgtagc ggatagagcc ctaacaacta aaatttccga agtgcttacc       420
     gatgacgctg tggaggtgca ccgccatcat acaatcaacc atgtaatcga tgaaatggaa       480
     aagcacaggg tcagcaaagt aatagtgatt aacgatatgg gggacacagt cggtatgatc       540
     tctacgcggg atattgctct cagtgccatg gaggacaatg aaggtaaaat gcagtcaaag       600
     aatattaaaa tggcacgtaa acccacccag ggaggcgaaa aaacatacag gtatgtaaaa       660
     gacgtacctc tggtagcaga ggatataatg gtcgaacttg acggggttgt aaatatcgaa       720
     gataacctct cagatgcggc caaagtaatg gtagaaaaca atcgtacagg ccttcctgtc       780
     gaaaaggaag gaaagatagt aggaatcttg agcagaatcg atataataag ggctgcttga       840
//

If you have problems or comments...

PBIL Back to PBIL home page